Property Summary

NCBI Gene PubMed Count 26
PubMed Score 1138.69
PubTator Score 215.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer -1.500 3.0e-04
medulloblastoma, large-cell 1.300 6.8e-05
pancreatic ductal adenocarcinoma liver m... -1.519 1.2e-02

 OMIM Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MDPYMIQMSSKGNLPSILDVHVNVGGRSSVPGKMKGRKARWSVRPSDMAKKTFNPIRAIVDNMKVKPNPN      1 - 70
KTMISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSREEIASYYHCPEAPLEAKDVIL     71 - 140
TSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTA    141 - 210
CLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLSTDVPILSCGGLAK    211 - 280
RWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNA    281 - 350
DLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLVAEQSVHCLPATCFEYPNFIRVVI    351 - 420
TVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK                                        421 - 454
//

Text Mined References (29)

PMID Year Title