Property Summary

NCBI Gene PubMed Count 132
Grant Count 55
R01 Count 30
Funding $4,147,831
PubMed Score 269.50
PubTator Score 169.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
ependymoma 1.200 0.014
osteosarcoma 2.635 0.000
glioblastoma 1.400 0.000
non-small cell lung cancer -1.070 0.000
group 3 medulloblastoma 1.300 0.006
Alzheimer's disease 1.100 0.026
Pick disease 1.700 0.000
progressive supranuclear palsy 1.100 0.027
ovarian cancer -1.900 0.000

Synonym

Accession P17706 A8K955 A8MXU3 K7ENG3 Q96AU5 Q96HR2
Symbols PTN2
PTPT
TCPTP
TC-PTP
TCELLPTP

Gene

PDB

1L8K  

Gene RIF (89)

PMID Text
26734582 role of PTPN2 in type 1 diabetes and Crohn's disease (review)
26344020 rs2542151 SNP in The PTPN2 gene is associated with T1DM in Chinese Han children
26208487 Loss of protein tyrosine phosphatase, non-receptor type 2 is associated with activation of AKT and tamoxifen resistance in breast cancer.
26139109 PTPN2 is linked to the pathogenesis of rheumatoid arthritis via synovial fibroblasts. It is a regulator of lnterleukin-6 production in rheumatoid arthritis synovial fibroblasts.
26090670 Angiopoietin-1 Regulates Brain Endothelial Permeability through PTPN-2 Mediated Tyrosine Dephosphorylation of Occludin
26026268 demonstrate that SIPAR directly interacts with T cell protein tyrosine phosphatase TC45 and enhances its association with STAT3
25492475 dysfunction of PTPN2 results in aberrant T-cell differentiation and intestinal dysbiosis similar to those observed in human CD. Our findings indicate a novel and crucial role for PTPN2 in chronic intestinal inflammation.
25489960 Single-nucleotide polymorphism in PTPN2 gene is associated with Crohn's disease.
25460303 PTPN2 and genes of the vitamin D pathway may have roles in risk of juvenile idiopathic arthritis
25311528 FGFR3 regulation by PTPN1 and PTPN2 depend on FGFR3 localization and A-loop sequence.
More...

AA Sequence

MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYIN      1 - 70
ASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETG     71 - 140
FSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHG    141 - 210
PAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIK    211 - 280
GDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALR    281 - 350
KRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL         351 - 415
//

Text Mined References (143)

PMID Year Title
26734582 2015 Genetic Variations of PTPN2 and PTPN22: Role in the Pathogenesis of Type 1 Diabetes and Crohn's Disease.
26344020 2015 Genetic Variants of PTPN2 Gene in Chinese Children with Type 1 Diabetes Mellitus.
26208487 2015 Loss of protein tyrosine phosphatase, non-receptor type 2 is associated with activation of AKT and tamoxifen resistance in breast cancer.
26139109 2015 Protein tyrosine phosphatase nonreceptor type 2: an important regulator of lnterleukin-6 production in rheumatoid arthritis synovial fibroblasts.
26090670 2015 Angiopoietin-1 Regulates Brain Endothelial Permeability through PTPN-2 Mediated Tyrosine Dephosphorylation of Occludin.
26026268 2015 Nuclear termination of STAT3 signaling through SIPAR (STAT3-Interacting Protein As a Repressor)-dependent recruitment of T cell tyrosine phosphatase TC-PTP.
25492475 2015 PTPN2 controls differentiation of CD4? T cells and limits intestinal inflammation and intestinal dysbiosis.
25489960 2015 Immunochip analysis identification of 6 additional susceptibility loci for Crohn's disease in Koreans.
25460303 2015 Epistasis amongst PTPN2 and genes of the vitamin D pathway contributes to risk of juvenile idiopathic arthritis.
25311528 2015 Differential regulation of FGFR3 by PTPN1 and PTPN2.
More...