Property Summary

NCBI Gene PubMed Count 703
PubMed Score 1317.61
PubTator Score 1892.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Asthma 385 0.0 0.0
Disease Target Count
Bipolar Disorder 666
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Pre-Eclampsia 68 5.042 2.5
Cancer 2499 4.337 2.2
Disease Target Count
Asthma, susceptibility to 11

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.200 4.7e-02
Astrocytoma, Pilocytic 1.500 1.7e-09
breast carcinoma 1.500 4.3e-03
cutaneous lupus erythematosus 1.100 2.0e-03
ependymoma 1.100 4.9e-07
glioblastoma 1.100 3.7e-03
inflammatory breast cancer 1.300 1.3e-02
juvenile dermatomyositis 1.063 5.2e-08
lung cancer -1.300 9.4e-04
Multiple myeloma 1.057 4.6e-02
osteosarcoma 1.307 7.8e-04
ovarian cancer -1.400 3.7e-04
pediatric high grade glioma 1.200 1.1e-04
psoriasis 1.400 3.7e-04
subependymal giant cell astrocytoma 1.401 3.7e-02

Protein-protein Interaction (7)

Gene RIF (747)

AA Sequence

MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME      1 - 70
PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQY     71 - 140
AYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPK    141 - 210
THVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD                281 - 338
//

Text Mined References (708)

PMID Year Title