Property Summary

NCBI Gene PubMed Count 633
Grant Count 198
R01 Count 99
Funding $30,494,174.68
PubMed Score 1275.89
PubTator Score 1892.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 1.057 0.046
astrocytoma 2.300 0.005
cutaneous lupus erythematosus 1.100 0.002
psoriasis 1.400 0.000
glioblastoma 3.100 0.000
osteosarcoma 1.307 0.001
posterior fossa group A ependymoma 1.300 0.000
juvenile dermatomyositis 1.780 0.000
lung cancer -1.900 0.000
breast carcinoma 1.500 0.004
pediatric high grade glioma 1.200 0.000
pilocytic astrocytoma 1.700 0.000
subependymal giant cell astrocytoma 1.690 0.027
inflammatory breast cancer 1.300 0.013
ovarian cancer 2.200 0.000

Synonym

Accession P17693
Symbols MHC-G

Gene

PDB

1YDP   2D31   2DYP   3BZE   3CDG   3CII   3KYN   3KYO  

Gene RIF (697)

PMID Text
27454993 The HLA-G 3'UTR of Dai and Shui people who lived in southern China may have subjected to a selection pressure.
26889902 data suggest an important influence of HLA-G 3'UTR polymorphisms in PCa susceptibility and support the use of the +3003 variant as a tag SNP for PCa risk.
26753410 HLA-G plays a role in many forms of immune tolerance, including feto-maternal tolerance, transplantation, tumor escape, and all levels of the immune response. Review.
26742443 HLA-G gene polymorphisms do not clearly affect the risk for implantation failure in most couples who undergo ART. However allelic variations, particularly in exons 3 and 4, and intron 2 of the HLA-G gene can lead to ART failure in human embryos.
26711580 HLA-G 14 bp insertion/deletion polymorphism is a risk factor for susceptibility to multiple sclerosis.
26667769 The HLA-G 14-bp indel polymorphism is associated with susceptibility to a subgroup of autoimmune diseases such as systemic lupus erythematosus, but not rheumatoid arthritis, multiple sclerosis, or Crohn's disease. (Meta-analysis)
26634551 Our results suggest that the HLA-G 14-bp INS/DEL polymorphism is unrelated to the development of AID.
26633805 study shows a prognostic and independent role of 3 HLA-G 3'UTR SNPs, +2960 14-bp INDEL, +3035 C>T, and +3187 A>G
26627200 TGF-beta could induce HLA-G expression in GC by inhibiting miR-152, involving its negative regulation on HLA-G
26585776 genetic polymorphism is associated with gastric adenocarcinoma in Iranian patients
More...

AA Sequence

MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME      1 - 70
PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQY     71 - 140
AYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPK    141 - 210
THVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD                281 - 338
//

Text Mined References (634)

PMID Year Title
27454993 2016 [Impact of natural selection on the polymorphism of HLA-G 3'UTR among five ethnic Chinese populations].
26889902 2016 Immunogenetics of prostate cancer and benign hyperplasia--the potential use of an HLA-G variant as a tag SNP for prostate cancer risk.
26753410 [HLA-G: from feto-maternal tolerance to organ acceptance].
26742443 2015 The Relationship between HLA-G Gene Polymorphisms and Repeated Implantation Failure in Infertile Couples Undergoing Assisted Reproductive Technique.
26711580 2016 An investigation into the association between HLA-G 14 bp insertion/deletion polymorphism and multiple sclerosis susceptibility.
26667769 2015 Association between a Functional HLA-G 14-bp Insertion/deletion Polymorphism and Susceptibility to Autoimmune Diseases: A Meta-analysis.
26634551 2015 Relationship between the HLA-G 14 bp insertion/deletion polymorphism and susceptibility to autoimmune disease: a meta-analysis.
26633805 2015 HLA-G 3'UTR Polymorphisms Impact the Prognosis of Stage II-III CRC Patients in Fluoropyrimidine-Based Treatment.
26627200 2015 TGF-? induces HLA-G expression through inhibiting miR-152 in gastric cancer cells.
26585776 2016 Association of HLA-G*01:01:02:01/G*01:04:01 polymorphism with gastric adenocarcinoma.
More...