Property Summary

NCBI Gene PubMed Count 341
PubMed Score 793.55
PubTator Score 669.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.86000694153267E-21
chronic lymphosyte leukemia 232 1.56730798482672E-8
ulcerative colitis 2087 4.54486197390691E-7
pituitary cancer 1972 7.90399006236751E-7
Breast cancer 3099 1.43376831252906E-6
medulloblastoma, large-cell 6234 2.18213015108952E-6
group 4 medulloblastoma 1875 2.74883553153454E-6
lung cancer 4473 1.74998860292429E-5
glioblastoma 5572 2.82083500393508E-4
pancreatic cancer 2300 6.36894812388846E-4
primary pancreatic ductal adenocarcinoma 1271 6.68906549289287E-4
ovarian cancer 8492 0.00261050612014111
astrocytoma 1493 0.00280629070117948
gastric carcinoma 832 0.00650562122454393
primitive neuroectodermal tumor 3031 0.0121611973391563
Multiple myeloma 1328 0.0193652043814264
mucosa-associated lymphoid tissue lymphoma 480 0.0395891305933321
Disease Target Count Z-score Confidence
Cancer 2346 4.462 2.2
Obesity 616 4.157 2.1
Holt-Oram syndrome 14 3.252 1.6

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.018 0.019
glioblastoma 2.000 0.000
chronic lymphosyte leukemia -1.500 0.000
group 4 medulloblastoma -2.900 0.000
astrocytoma 1.600 0.003
medulloblastoma, large-cell -2.900 0.000
primitive neuroectodermal tumor -1.100 0.012
primary pancreatic ductal adenocarcinoma 1.943 0.001
lung cancer -3.100 0.000
lung carcinoma -1.600 0.000
gastric carcinoma 2.200 0.007
mucosa-associated lymphoid tissue lympho... 1.080 0.040
ulcerative colitis 2.100 0.000
ovarian cancer 1.900 0.003
Breast cancer -1.200 0.000
pituitary cancer -1.800 0.000
pancreatic cancer 1.900 0.001

Synonym

Accession P17676 A8K671 Q96IH2 Q9H4Z5 C/EBP beta
Symbols TCF5
IL6DBP
NF-IL6
C/EBP-beta

Gene

PANTHER Protein Class (1)

PDB

1GTW   1GU4   1GU5   1H88   1H89   1H8A   1HJB   1IO4   2E42   2E43  

  Ortholog (7)

Species Source
Chimp OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (267)

PMID Text
26968249 C/EBPbeta promotes autophagy in PC3 cells by augmenting REDD1 expression.
26709824 Loss of C/EBPbeta expression in primary myoblasts rescues differentiation under cachectic conditions without restoring myotube size, indicating that C/EBPbeta is an important inhibitor of myogenesis in cancer cachexia.
26522356 C/EBPbeta could promote the invasion and migration of human renal carcinoma 786-O cells, and had an inducing effect on nuclear translocation of NF-kappaB in 786-O cells.
26514342 C/EBPbeta and NFkappaB inhibition by melatonin may impede both gastric tumor growth and peritoneal dissemination by inducing ER stress and inhibiting EMT.
26511475 Letter: elevated C/EBPbeta in advanced COPD may be an indication of a breakdown of regulatory mechanisms and excessive inflammation.
26166436 the oxidative stress-induced overexpression of C/EBPbeta might influence the activity of MMPs by regulating the Wnt/beta-catenin signaling pathway to affect the invasion of trophoblast cells, and participate in the pathogenesis of preeclampsia.
26111340 Global profiling in human mesenchymal stem cells and a novel cell-free assay reveals that ATF4 requires C/EBPbeta for genomic binding at a motif distinct from that bound by the C/EBPbeta homodimer.
25965830 Low CEBPB expression is associated with metastasis in hepatocellular carcinoma.
25959126 TNF-a induced MMP1/3 expression, which was abrogated by C/EBPb knockdown or p38 MAPK inhibition.
25940801 The C/EBPbeta transcription factor plays a role in hematological malignancies of both myeloid and lymphoid lineage origin. [Review]
More...

AA Sequence

MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHE      1 - 70
RAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYV     71 - 140
SLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAY    141 - 210
LGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRER    211 - 280
NNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC         281 - 345
//

Text Mined References (349)

PMID Year Title
26968249 2016 C/EBP? regulates sensitivity to bortezomib in prostate cancer cells by inducing REDD1 and autophagosome-lysosome fusion.
26709824 2015 Expression of CCAAT/Enhancer Binding Protein Beta in Muscle Satellite Cells Inhibits Myogenesis in Cancer Cachexia.
26522356 2015 [C/EBP? promotes NF-?B-mediated invasion and migration of human renal carcinoma 786-O cells].
26514342 2016 Melatonin set out to ER stress signaling thwarts epithelial mesenchymal transition and peritoneal dissemination via calpain-mediated C/EBP? and NF?B cleavage.
26511475 2015 Small airway epithelial-C/EBP? is increased in patients with advanced COPD.
26166436 2015 Oxidative stress-induced C/EBP? inhibits ?-catenin signaling molecule involving in the pathology of preeclampsia.
26111340 2015 ATF4 licenses C/EBP? activity in human mesenchymal stem cells primed for adipogenesis.
25965830 2015 Orosomucoid 2 inhibits tumor metastasis and is upregulated by CCAAT/enhancer binding protein ? in hepatocellular carcinomas.
25959126 2015 C/EBP? Mediates TNF-?-Induced Cancer Cell Migration by Inducing MMP Expression Dependent on p38 MAPK.
25940801 2015 Non-steady-state hematopoiesis regulated by the C/EBP? transcription factor.
More...