Property Summary

NCBI Gene PubMed Count 341
Grant Count 440
R01 Count 289
Funding $43,476,423.57
PubMed Score 793.55
PubTator Score 669.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Multiple myeloma 1.018 0.019
glioblastoma 2.000 0.000
chronic lymphosyte leukemia -1.500 0.000
group 4 medulloblastoma -2.900 0.000
astrocytoma 1.600 0.003
medulloblastoma, large-cell -2.900 0.000
primitive neuroectodermal tumor -1.100 0.012
primary pancreatic ductal adenocarcinoma 1.943 0.001
lung cancer -3.100 0.000
lung carcinoma -1.600 0.000
gastric carcinoma 2.200 0.007
mucosa-associated lymphoid tissue lympho... 1.080 0.040
ulcerative colitis 2.100 0.000
ovarian cancer 1.900 0.003
Breast cancer -1.200 0.000
pituitary cancer -1.800 0.000
pancreatic cancer 1.900 0.001

Synonym

Accession P17676 A8K671 Q96IH2 Q9H4Z5 C/EBP beta
Symbols TCF5
IL6DBP
NF-IL6
C/EBP-beta

Gene

PANTHER Protein Class (1)

PDB

1GTW   1GU4   1GU5   1H88   1H89   1H8A   1HJB   1IO4   2E42   2E43  

Gene RIF (269)

PMID Text
26968249 C/EBPbeta promotes autophagy in PC3 cells by augmenting REDD1 expression.
26709824 Loss of C/EBPbeta expression in primary myoblasts rescues differentiation under cachectic conditions without restoring myotube size, indicating that C/EBPbeta is an important inhibitor of myogenesis in cancer cachexia.
26522356 C/EBPbeta could promote the invasion and migration of human renal carcinoma 786-O cells, and had an inducing effect on nuclear translocation of NF-kappaB in 786-O cells.
26514342 C/EBPbeta and NFkappaB inhibition by melatonin may impede both gastric tumor growth and peritoneal dissemination by inducing ER stress and inhibiting EMT.
26511475 Letter: elevated C/EBPbeta in advanced COPD may be an indication of a breakdown of regulatory mechanisms and excessive inflammation.
26166436 the oxidative stress-induced overexpression of C/EBPbeta might influence the activity of MMPs by regulating the Wnt/beta-catenin signaling pathway to affect the invasion of trophoblast cells, and participate in the pathogenesis of preeclampsia.
26111340 Global profiling in human mesenchymal stem cells and a novel cell-free assay reveals that ATF4 requires C/EBPbeta for genomic binding at a motif distinct from that bound by the C/EBPbeta homodimer.
25965830 Low CEBPB expression is associated with metastasis in hepatocellular carcinoma.
25959126 TNF-a induced MMP1/3 expression, which was abrogated by C/EBPb knockdown or p38 MAPK inhibition.
25940801 The C/EBPbeta transcription factor plays a role in hematological malignancies of both myeloid and lymphoid lineage origin. [Review]
More...

AA Sequence

MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHE      1 - 70
RAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYV     71 - 140
SLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAY    141 - 210
LGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRER    211 - 280
NNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC         281 - 345
//

Publication (349)

PMID Year Title
26968249 2016 C/EBP? regulates sensitivity to bortezomib in prostate cancer cells by inducing REDD1 and autophagosome-lysosome fusion.
26709824 2015 Expression of CCAAT/Enhancer Binding Protein Beta in Muscle Satellite Cells Inhibits Myogenesis in Cancer Cachexia.
26522356 2015 [C/EBP? promotes NF-?B-mediated invasion and migration of human renal carcinoma 786-O cells].
26514342 2016 Melatonin set out to ER stress signaling thwarts epithelial mesenchymal transition and peritoneal dissemination via calpain-mediated C/EBP? and NF?B cleavage.
26511475 2015 Small airway epithelial-C/EBP? is increased in patients with advanced COPD.
26166436 2015 Oxidative stress-induced C/EBP? inhibits ?-catenin signaling molecule involving in the pathology of preeclampsia.
26111340 2015 ATF4 licenses C/EBP? activity in human mesenchymal stem cells primed for adipogenesis.
25965830 2015 Orosomucoid 2 inhibits tumor metastasis and is upregulated by CCAAT/enhancer binding protein ? in hepatocellular carcinomas.
25959126 2015 C/EBP? Mediates TNF-?-Induced Cancer Cell Migration by Inducing MMP Expression Dependent on p38 MAPK.
25940801 2015 Non-steady-state hematopoiesis regulated by the C/EBP? transcription factor.
More...