Property Summary

NCBI Gene PubMed Count 365
PubMed Score 857.85
PubTator Score 669.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.600 2.8e-03
Breast cancer -1.200 1.4e-06
chronic lymphosyte leukemia -1.500 1.6e-08
gastric carcinoma 2.200 6.5e-03
glioblastoma 2.000 2.8e-04
group 3 medulloblastoma -2.300 1.4e-05
lung cancer -2.700 9.0e-06
lung carcinoma -1.600 2.9e-21
medulloblastoma, large-cell -2.900 2.2e-06
mucosa-associated lymphoid tissue lympho... 1.080 4.0e-02
Multiple myeloma 1.018 1.9e-02
ovarian cancer -1.500 6.1e-03
pancreatic cancer 1.900 6.4e-04
pituitary cancer -1.800 7.9e-07
primary pancreatic ductal adenocarcinoma 1.943 6.7e-04
primitive neuroectodermal tumor -1.100 1.2e-02
ulcerative colitis 2.100 4.5e-07

Gene RIF (290)

AA Sequence

MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHE      1 - 70
RAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYV     71 - 140
SLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAY    141 - 210
LGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRER    211 - 280
NNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC         281 - 345
//

Text Mined References (374)

PMID Year Title