Property Summary

NCBI Gene PubMed Count 121
PubMed Score 36.65
PubTator Score 2135.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
Myopathy 185 0.0 4.0
limb-girdle muscular dystrophy 37 0.0 4.0
Disease Target Count Z-score Confidence
Avian influenza 7 3.28 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer -2.900 4.2e-09
lung adenocarcinoma -1.300 4.8e-12
lung carcinoma -1.500 2.0e-10
non-small cell lung cancer -1.583 4.9e-17
pancreatic cancer -1.200 1.5e-02
primary pancreatic ductal adenocarcinoma -1.154 2.2e-02
psoriasis -1.300 1.6e-02

Gene RIF (83)

AA Sequence

MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLR      1 - 70
ASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEV     71 - 140
NRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAA    141 - 210
FRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQ    211 - 280
YETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMR    281 - 350
ELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPI    351 - 420
QTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL                        421 - 470
//

Text Mined References (137)

PMID Year Title