Property Summary

NCBI Gene PubMed Count 10
PubMed Score 36.25
PubTator Score 21.44

Knowledge Summary

Patent (1,758)


  Disease Sources (2)


Accession P17658
Symbols HBK2


  Ortholog (8)

Gene RIF (3)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18474843 The spectrum of neurologic manifestations and neoplasms associated with voltage-gated potassium channel (VGKC) autoimmunity is broader than previously recognized
18162557 analysis of how the RCK2 domain of the human BKCa channel is a calcium sensor

AA Sequence

ATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRMLTEV                                   491 - 529

Text Mined References (11)

PMID Year Title
27619418 2016 Pore size matters for potassium channel conductance.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18474843 2008 Clinical spectrum of voltage-gated potassium channel autoimmunity.
18162557 2008 The RCK2 domain of the human BKCa channel is a calcium sensor.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14575698 2003 Human Kv1.6 current displays a C-type-like inactivation when re-expressed in cos-7 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8821794 1995 Characterization of a voltage-activated K-channel gene cluster on human chromosome 12p13.