Property Summary

Ligand Count 3
NCBI Gene PubMed Count 10
PubMed Score 36.75
PubTator Score 21.44

Knowledge Summary

Patent (1,758)

TINX Plot

  Disease (3)

Gene RIF (3)

AA Sequence

MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGCCSSERLVINISGLRFETQLRTLSLFPDTLLGDP      1 - 70
GRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFLEEIRFYQLGDEALAAFREDEGC     71 - 140
LPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPQFRVDGRGGNNGG    141 - 210
VSRVSPVSRGSQEEEEDEDDSYTFHHGITPGEMGTGGSSSLSTLGGSFFTDPFFLVETLCIVWFTFELLV    211 - 280
RFSACPSKPAFFRNIMNIIDLVAIFPYFITLGTELVQQQEQQPASGGGGQNGQQAMSLAILRVIRLVRVF    281 - 350
RIFKLSRHSKGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTM    351 - 420
TTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHVTCGQPAPDLR    421 - 490
ATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRMLTEV                                   491 - 529
//

Text Mined References (11)

PMID Year Title