Property Summary

NCBI Gene PubMed Count 106
PubMed Score 45.42
PubTator Score 241.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Leukemia, Myelocytic, Acute 113
Disease Target Count P-value
posterior fossa group A ependymoma 1511 5.63450203416046E-12
acute quadriplegic myopathy 1157 2.80803803382364E-8
pilocytic astrocytoma 3086 3.53874384451216E-8
ovarian cancer 8492 1.32395811743238E-7
lung cancer 4473 5.38032542472131E-6
diabetes mellitus 1663 0.00381373731590294
interstitial lung disease 292 0.00469285657426743
astrocytoma 1493 0.00525360078521626
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00564896269985011
subependymal giant cell astrocytoma 2287 0.0134256457118736
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0161810740560613
oligodendroglioma 2849 0.0172743681988555
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0411018976528595
glioblastoma 5572 0.0443369819921974

Expression

Synonym

Accession P17655 A6NDG7 B7ZA96 E7ES58 Q16738 Q6PJT3 Q8WU26 Q9HBB1
Symbols CANP2
mCANP
CANPL2
CANPml

Gene

PDB

1KFU   1KFX   2NQA  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (72)

PMID Text
26358320 Taken together, our results demonstrated the deregulation of GAS2 in both AML and ALL and the requirement of GAS2-Calpain2 axis for the growth of leukemic cells.
26248159 Calpain-2 modulates pulmonary vascular remodeling in pulmonary arterial hypertension.
25944670 The combination of Ca2+ and ionomycin was required to activate calpain 2, resulting in the further degradation of Dicer and the appearance of a degradation product similar to that detected in platelets from some diabetic individuals.
23940116 The data reveal that hGAAP is a novel regulator of focal adhesion dynamics, cell adhesion, and migration by controlling localized Ca(2+)-dependent activation of calpain 2.
23889979 In a transgenic mouse model, hypoxia-triggered m-calpain activation is involved in endoplasmic reticulum stress-mediated Alzheimer's disease pathogenesis.
23733271 Small interfering RNA (siRNA)-mediated silencing of m-calpain expression significantly suppressed the adhesive, migrative and invasive potentials of human hepatoma cells.
23538341 alpha-II spectrin was drastically accumulated in infected T cells derived from adult T-cell leukemia patients, whereas its digestive protease calpain-2 (CAN2) was significantly downregulated.
23466492 The carboxyl tail of alpha-actinin-4 regulates its susceptibility to m-calpain and thus functions in cell migration and spreading.
23389291 data demonstrate that GSK-3beta plays an important role in regulating tRXRalpha production by calpain II in cancer cells
23140395 The results suggest that calpain-2 and calpastatin expression is important in pancreatic cancers, influencing disease progression
More...

AA Sequence

MAGIAAKLAKDREAAEGLGSHDRAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGFKELGPYSSKT      1 - 70
RGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQSFQENYAGIFH     71 - 140
FQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGATTEGFEDFTGG    141 - 210
IAEWYELKKPPPNLFKIIQKALQKGSLLGCSIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQK    211 - 280
LIRIRNPWGEVEWTGRWNDNCPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTS    281 - 350
DTYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR    351 - 420
KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPGEYILVPSTFE    421 - 490
PNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRV    491 - 560
LAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKA    561 - 630
LEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL    631 - 700
//

Text Mined References (110)

PMID Year Title
26358320 2015 GAS2-Calpain2 axis contributes to the growth of leukemic cells.
26248159 2016 Activation of Calpain-2 by Mediators in Pulmonary Vascular Remodeling of Pulmonary Arterial Hypertension.
25944670 2015 Dicer cleavage by calpain determines platelet microRNA levels and function in diabetes.
25344690 2014 Common variants associated with general and MMR vaccine-related febrile seizures.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23940116 2013 hGAAP promotes cell adhesion and migration via the stimulation of store-operated Ca2+ entry and calpain 2.
23889979 2013 Hypoxia-triggered m-calpain activation evokes endoplasmic reticulum stress and neuropathogenesis in a transgenic mouse model of Alzheimer's disease.
23733271 2013 Calpains are required for invasive and metastatic potentials of human HCC cells.
23538341 2013 Preapoptotic protease calpain-2 is frequently suppressed in adult T-cell leukemia.
More...