Property Summary

NCBI Gene PubMed Count 76
Grant Count 494
R01 Count 271
Funding $62,397,689.11
PubMed Score 843.95
PubTator Score 232.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
astrocytic glioma -1.900 0.008
ependymoma -2.000 0.015
oligodendroglioma -2.000 0.007
cutaneous lupus erythematosus -3.700 0.017
psoriasis 1.600 0.009
glioblastoma -1.400 0.001
primitive neuroectodermal tumor -1.700 0.000
non-small cell lung cancer -1.646 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.007
lung adenocarcinoma -1.100 0.000

Synonym

Accession P17643 P78468 P78469 Q13721 Q15679 DHICA oxidase
Symbols TRP
CAS2
CATB
GP75
OCA3
TRP1
TYRP
b-PROTEIN

Gene

PANTHER Protein Class (2)

Gene RIF (50)

PMID Text
26252096 Mutation in TYRP1 is associated with oculocutaneous albinism.
26068396 Polymorphisms in 3'UTR of TYRP1 mRNA can affect TYRP1 mRNA regulation by miR-155 and its subsequent translation into protein. These SNPs can render TYRP1 mRNA and protein expression nonsusceptible to miR-155 activity
25837821 Single nucleotide polymorphisms in TYRP1 gene is associated with multiple primary melanoma.
25240771 These data suggest that UVB-stimulated Ucn1 contributes to TRP1 production via the transcription of both Nurr-1 and Nur77. Ucn1, produced in melanoma cells, acts on melanoma cells themselves in an autocrine manner.
25054620 These data indicate that galectin-3 is a regulatory component in melanin synthesis affecting the expression of Tyrp-1.
24475287 p53 regulation by TRP2 is not pervasive in melanoma.
23862152 Due to mutation in Tyrp1 protein, it became more rigid and might disturb the structural conformation and catalytic function of the structure and might also play a significant role in inducing oculocutaneous albinism type III.
23519055 High TYRP1/S100B mRNA expression in lymph node metastases from melanoma patients is associated with unfavourable clinical outcome.
23416839 in human melanoma HMV-II cells both CRF and Ucn1 regulate TRP1 gene expression via Nurr-1/Nur77 production, independent of pro-opiomelanocortin or alpha-melanocyte-stimulating hormone stimulation.
23190901 We report four Pakistani albinism mutations, including three SLC45A2 alleles and one 22-nucleotide deletion in TYRP1.
More...

AA Sequence

MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTA      1 - 70
DSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEE     71 - 140
KNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGE    141 - 210
VDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPN    211 - 280
SVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSN    281 - 350
STNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA    351 - 420
DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIAIAVVGALLLV    421 - 490
ALIFGTASYLIRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV                           491 - 537
//

Text Mined References (77)

PMID Year Title
26252096 2015 [Suspected pathogenic mutation identified in two cases with oculocutaneous albinism].
26068396 2015 SNPs at miR-155 binding sites of TYRP1 explain discrepancy between mRNA and protein and refine TYRP1 prognostic value in melanoma.
25837821 2015 Inherited genetic variants associated with occurrence of multiple primary melanoma.
25240771 2014 Ultraviolet B radiation-stimulated urocortin 1 is involved in tyrosinase-related protein 1 production in human melanoma HMV-II cells.
25054620 2015 Melanocytic galectin-3 is associated with tyrosinase-related protein-1 and pigment biosynthesis.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24475287 2014 p53 regulation by TRP2 is not pervasive in melanoma.
23862152 2013 In silico screening and molecular dynamics simulation of disease-associated nsSNP in TYRP1 gene and its structural consequences in OCA3.
23548203 2013 Genome-wide association studies identify several new loci associated with pigmentation traits and skin cancer risk in European Americans.
23519055 2013 Tyrosinase-related protein 1 mRNA expression in lymph node metastases predicts overall survival in high-risk melanoma patients.
More...