Property Summary

NCBI Gene PubMed Count 442
Grant Count 10
Funding $1,735,679.1
PubMed Score 9.59
PubTator Score 163.77

Knowledge Summary

Patent (4,564)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.100 0.008
group 3 medulloblastoma -1.500 0.003

Synonym

Accession P17612 Q32P54 Q9H2Y0 Q9NRB4 Q9NRH9 PKA C-alpha
Symbols PKACA
PPNAD4

Gene

PDB

2GU8   3AGL   3AGM   3AMA   3AMB   3L9L   3L9M   3L9N   3MVJ   3NX8   3OOG   3OVV   3OWP   3OXT   3P0M   3POO   3VQH   4AE6   4AE9   4UJ1   4UJ2   4UJ9   4UJA   4UJB   4WB5   4WB6   4WB7   4WB8   5IZF   5IZJ   5J5X  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
524 screening 94 / 0 / 64831 Primary biochemical high-throughput screening assay for inhibitors of protein kinase A (PKA) activity
548 confirmatory 62 / 0 / 32 Dose-response biochemical assay for inhibitors of protein kinase A (PKA) activity
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
504583 confirmatory 3 / 1 / 25 Protein Kinase A Activity Assay Measured in Biochemical System Using Plate Reader - 2052-04_Inhibitor_Dose_DryPowder_Activity
588629 confirmatory 6 / 6 / 70 Protein Kinase A Activity Assay Measured in Biochemical System Using Plate Reader - 2052-04_Inhibitor_Dose_DryPowder_Activity_Set2

Gene RIF (192)

PMID Text
26978032 Our results reveal for the first time the role of the versatile PKA in cancer cells survival under chronic glucose starvation and anoikis and may be a novel potential target for cancer treatment.
26701869 No somatic mutations were observed in PRKACA in a cohort of GH-secreting pituitary adenomas.
26669444 Data show that activated PKA phosphorylates the 19S subunit, Rpn6/PSMD11 (regulatory particle non-ATPase 6/proteasome subunit D11) at Ser14.
26505878 DNAJB1-PRKACA was evaluated as a key driver of fibrolamellar carcinoma and as a candidate therapeutic target
26435498 Akt and PKA phosphorylated KLHL3 at S433, and phosphorylation of KLHL3 by PKA inhibited WNK4 degradation.
26387949 PKA phosphorylates the ATPase inhibitory factor 1 and inactivates its capacity to bind and inhibit the mitochondrial H(+)-ATP synthase.
26358293 Data indicate that protein kinase A (PKA) phosphorylates only serine-253 amino acid on activator of G-protein signaling 1 protein Dexras1 (RASD1).
26258546 Protein kinase A activity is necessary for fission and fusion of Golgi to endoplasmic reticulum retrograde tubules.
26052940 Kapbeta2 interacts with ULK2 through ULK2's putative PY-NLS motif, and facilitates transport from the cytoplasm to the nucleus, depending on its Ser1027 residue phosphorylation by PKA, thereby reducing autophagic activity.
25951193 ITM2A expression is positively regulated by PKA-CREB signaling and ITM2A expression interferes with autophagic flux by interacting with vacuolar ATPase.
More...

AA Sequence

MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHY      1 - 70
AMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFS     71 - 140
EPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEI    141 - 210
ILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTK    211 - 280
RFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSE    281 - 350
F//

Text Mined References (459)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26978032 2016 Protein Kinase A Activation Promotes Cancer Cell Resistance to Glucose Starvation and Anoikis.
26701869 2016 Landscape of somatic mutations in sporadic GH-secreting pituitary adenomas.
26669444 2015 cAMP-induced phosphorylation of 26S proteasomes on Rpn6/PSMD11 enhances their activity and the degradation of misfolded proteins.
26505878 2016 The DNAJB1-PRKACA chimera: Candidate biomarker and therapeutic target for fibrolamellar carcinomas.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26435498 2015 Impaired degradation of WNK by Akt and PKA phosphorylation of KLHL3.
26387949 2015 PKA Phosphorylates the ATPase Inhibitory Factor 1 and Inactivates Its Capacity to Bind and Inhibit the Mitochondrial H(+)-ATP Synthase.
26358293 2015 PKA-mediated phosphorylation of Dexras1 suppresses iron trafficking by inhibiting S-nitrosylation.
26258546 2015 Protein kinase A activity is necessary for fission and fusion of Golgi to endoplasmic reticulum retrograde tubules.
More...