Property Summary

NCBI Gene PubMed Count 53
Grant Count 148
R01 Count 98
Funding $14,366,535.3
PubMed Score 687.92
PubTator Score 359.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession P17600 B1AJQ1 O75825 Q5H9A9
Symbols SYNI
SYN1a
SYN1b

Gene

Gene RIF (20)

PMID Text
26823711 Cerebral malaria causes pre-synaptic excitation and eventually activation of synapsin I, leading to increased neurotransmitter release.
26204769 Patterns of the immunoreactivity with antibodies to SNAP-25, synapsin-I and synaptophysin are completely appropriate to those of adult's OB on the 38-40 weeks of the prenatal development.
24312498 these findings suggest PRICKLE1 mutations contribute to ASD by disrupting the interaction with SYN1 and regulation of synaptic vesicles.
24088370 The implementation of the AlphaScreen pSYN1 assay and future development of additional primary neuronal HTS assays provides an attractive approach for discovery of novel classes of therapeutic candidates for a variety of CNS disorders.
23818987 Data indicate that in patients carrying the W356x mutation the function of synapsin I is markedly impaired, and support the value of Syn1(-/-) mice as an experimental model mimicking the human pathology.
23406870 Epileptogenic Q555X SYN1 mutant triggers imbalances in release dynamics and short-term plasticity.
23250796 A conserved region of human and mouse SYN1 promoters contains cis-sites for the transcriptional activator Sp1 in close proximity to REST binding motifs.
23190742 Treatment of microglia cells with HIV-1 Tat shows TAU5 and synapsin-1 positive inclusions in cells
22807112 The allelic frequencies of SYN1 are associated with Korean female schizophrenia.
22571925 The histone modification marks were significantly increased in major depression and this effect was correlated with significant increases in SYN1b gene expression.
More...

AA Sequence

MNYLRRRLSDSNFMANLPNGYMTDLQRPQPPPPPPGAHSPGATPGPGTATAERSSGVAPAASPAAPSPGS      1 - 70
SGGGGFFSSLSNAVKQTTAAAAATFSEQVGGGSGGAGRGGAASRVLLVIDEPHTDWAKYFKGKKIHGEID     71 - 140
IKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGI    141 - 210
PSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKV    211 - 280
KVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMS    281 - 350
DRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPR    351 - 420
QRQRDASPGRGSHGQTPSPGALPLGRQTSQQPAGPPAQQRPPPQGGPPQPGPGPQRQGPPLQQRPPPQGQ    421 - 490
QHLSGLGPPAGSPLPQRLPSPTSAPQQPASQAAPPTQGQGRQSRPVAGGPGAPPAARPPASPSPQRQAGP    491 - 560
PQATRQTSVSGPAPPKASGAPPGGQQRQGPPQKPPGPAGPTRQASQAGPVPRTGPPTTQQPRPSGPGPAG    561 - 630
RPKPQLAQKPSQDVPPPATAAAGGPPHPQLNKSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFA    631 - 700
SLFSD                                                                     701 - 705
//

Text Mined References (54)

PMID Year Title
26823711 2015 Increased synapsin I expression in cerebral malaria.
26204769 [Development of the Human Olfactory Bulbs in the Prenatal Ontogenesis: an Immunochistochemical Study with Markers of Presynaptic Terminals (anti-SNAP-25, -Synapsin-I, -Synaptophysin)].
24312498 2013 PRICKLE1 interaction with SYNAPSIN I reveals a role in autism spectrum disorders.
24088370 2014 Development of a high-throughput AlphaScreen assay for modulators of synapsin I phosphorylation in primary neurons.
23818987 2013 Nonsense-mediated mRNA decay and loss-of-function of the protein underlie the X-linked epilepsy associated with the W356× mutation in synapsin I.
23406870 2013 Epileptogenic Q555X SYN1 mutant triggers imbalances in release dynamics and short-term plasticity.
23250796 2013 Specificity protein 1 (Sp1)-dependent activation of the synapsin I gene (SYN1) is modulated by RE1-silencing transcription factor (REST) and 5'-cytosine-phosphoguanine (CpG) methylation.
22807112 2012 The C allele of synonymous SNP (rs1142636, Asn170Asn) in SYN1 is a risk factor for the susceptibility of Korean female schizophrenia.
22571925 2013 H3K4 tri-methylation in synapsin genes leads to different expression patterns in bipolar disorder and major depression.
22163275 2011 Redistribution of DAT/?-synuclein complexes visualized by "in situ" proximity ligation assay in transgenic mice modelling early Parkinson's disease.
More...