Property Summary

NCBI Gene PubMed Count 55
PubMed Score 712.44
PubTator Score 359.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.800 6.7e-06
astrocytic glioma -1.400 1.8e-02
Astrocytoma, Pilocytic -2.700 2.7e-09
atypical teratoid / rhabdoid tumor -3.400 3.1e-08
ependymoma -2.300 2.1e-02
glioblastoma -1.300 2.3e-03
group 3 medulloblastoma -2.600 5.0e-05
lung carcinoma 1.600 2.6e-38
malignant mesothelioma 2.300 6.3e-07
medulloblastoma, large-cell -1.500 1.0e-04
oligodendroglioma -1.800 8.5e-22
Pick disease -1.600 5.4e-03
primitive neuroectodermal tumor -1.800 2.1e-03
subependymal giant cell astrocytoma -3.031 4.7e-02
tuberculosis -2.000 1.0e-06

Gene RIF (21)

AA Sequence

MNYLRRRLSDSNFMANLPNGYMTDLQRPQPPPPPPGAHSPGATPGPGTATAERSSGVAPAASPAAPSPGS      1 - 70
SGGGGFFSSLSNAVKQTTAAAAATFSEQVGGGSGGAGRGGAASRVLLVIDEPHTDWAKYFKGKKIHGEID     71 - 140
IKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGI    141 - 210
PSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKV    211 - 280
KVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMS    281 - 350
DRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPR    351 - 420
QRQRDASPGRGSHGQTPSPGALPLGRQTSQQPAGPPAQQRPPPQGGPPQPGPGPQRQGPPLQQRPPPQGQ    421 - 490
QHLSGLGPPAGSPLPQRLPSPTSAPQQPASQAAPPTQGQGRQSRPVAGGPGAPPAARPPASPSPQRQAGP    491 - 560
PQATRQTSVSGPAPPKASGAPPGGQQRQGPPQKPPGPAGPTRQASQAGPVPRTGPPTTQQPRPSGPGPAG    561 - 630
RPKPQLAQKPSQDVPPPATAAAGGPPHPQLNKSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFA    631 - 700
SLFSD                                                                     701 - 705
//

Text Mined References (56)

PMID Year Title