Property Summary

NCBI Gene PubMed Count 104
Grant Count 165
R01 Count 76
Funding $24,719,481.55
PubMed Score 251.22
PubTator Score 209.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
pancreatic cancer 1.100 0.017
psoriasis -1.500 0.003
osteosarcoma -5.986 0.000
medulloblastoma, large-cell -1.300 0.000
tuberculosis 1.800 0.000
non-small cell lung cancer -1.981 0.000
lung cancer -2.800 0.000
interstitial cystitis 1.400 0.000
pancreatic carcinoma 1.100 0.017
lung adenocarcinoma -1.551 0.000
ductal carcinoma in situ -1.300 0.000
invasive ductal carcinoma -1.700 0.001

Synonym

Accession P17542 D3DQ24 TAL-1
Symbols SCL
TCL5
tal-1
bHLHa17

Gene

PDB

2YPA   2YPB  

Gene RIF (65)

PMID Text
27052461 Concurrent exogenous expression of three transcription factors, GATA1, FLI1 and TAL1, enables large-scale production of megakaryocytes from human pluripotent stem cells.
26053062 a successful induction of gamma-globin includes a reduction in BCL11A, KLF1 and TAL1 expression.
25971621 analysis of a point mutation that increases fetal globin expression through de novo recruitment of the activator TAL1 to promote chromatin looping of distal enhancers to the modified gamma-globin promoter
25564442 Scl binds to primed enhancers in mesoderm to regulate hematopoietic and cardiac fate divergence.
25528728 These results indicate that KLF1 plays a role in facilitating and/or stabilizing GATA-1 and TAL1 occupancy in the erythroid genes, contributing to the generation of active chromatin structure such as histone acetylation and chromatin looping
25394790 study found that heterozygous somatic mutations are acquired that introduce binding motifs for the MYB transcription factor in a precise noncoding site, which creates a super-enhancer upstream of the TAL1 oncogene; MYB binds to this new site
25292191 SCL-mediated transcriptional network enhances megakaryocytic specification of human embryonic stem cells.
24470145 The results indicate that TAL1 plays a critical role in chromatin loop formation between the gamma-globin genes and locus control region, which is a critical step for the transcription of the gamma-globin genes.
24405580 SCL/TAL1 is located in the up-stream of MEK/ERK pathway and partially regulates hematopoiesis by modulating the phosphorylation level of the key proteins in MEK/ERK pathway.
24395799 TAL1 is involved in regulating H3K27me3 variations in collaboration with GFI1B
More...

AA Sequence

MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGPGGGPAGGGGA      1 - 70
ARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQLSPPALAAPAAPGRALLYSL     71 - 140
SQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRIFTNSRERWRQQNVNGAFAEL    141 - 210
RKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDL    211 - 280
LQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR                       281 - 331
//

Text Mined References (106)

PMID Year Title
27052461 2016 Large-scale production of megakaryocytes from human pluripotent stem cells by chemically defined forward programming.
26053062 2015 Variation in Gamma-Globin Expression before and after Induction with Hydroxyurea Associated with BCL11A, KLF1 and TAL1.
25971621 2015 Editing the genome to introduce a beneficial naturally occurring mutation associated with increased fetal globin.
25564442 2015 Scl binds to primed enhancers in mesoderm to regulate hematopoietic and cardiac fate divergence.
25528728 2015 KLF1 stabilizes GATA-1 and TAL1 occupancy in the human ?-globin locus.
25394790 2014 Oncogene regulation. An oncogenic super-enhancer formed through somatic mutation of a noncoding intergenic element.
25292191 2015 SCL/TAL1-mediated transcriptional network enhances megakaryocytic specification of human embryonic stem cells.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24470145 2014 The hematopoietic regulator TAL1 is required for chromatin looping between the ?-globin LCR and human ?-globin genes to activate transcription.
24405580 Transcription factor SCL/TAL1 mediates the phosphorylation of MEK/ERK pathway in umbilical cord blood CD34? stem cells during hematopoietic differentiation.
More...