Property Summary

NCBI Gene PubMed Count 111
PubMed Score 258.80
PubTator Score 209.86

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
ductal carcinoma in situ -1.300 3.8e-04
interstitial cystitis 1.400 1.3e-05
invasive ductal carcinoma -1.700 1.3e-03
lung adenocarcinoma -1.100 5.2e-19
lung cancer -2.700 7.7e-05
medulloblastoma, large-cell -1.300 2.7e-05
non-small cell lung cancer -1.981 9.5e-25
osteosarcoma -1.599 1.6e-06
pancreatic cancer 1.100 1.7e-02
pancreatic carcinoma 1.100 1.7e-02
psoriasis -1.500 3.1e-03
tuberculosis 1.800 4.6e-05

Gene RIF (72)

AA Sequence

MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGPGGGPAGGGGA      1 - 70
ARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQLSPPALAAPAAPGRALLYSL     71 - 140
SQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRIFTNSRERWRQQNVNGAFAEL    141 - 210
RKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDL    211 - 280
LQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR                       281 - 331
//

Text Mined References (113)

PMID Year Title