Property Summary

NCBI Gene PubMed Count 25
PubMed Score 79.51
PubTator Score 24.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 2.5e-02
ductal carcinoma in situ -1.900 4.0e-04
ependymoma -1.400 2.0e-02
gastric carcinoma -2.900 4.2e-02
intraductal papillary-mucinous adenoma (... 1.700 3.9e-03
invasive ductal carcinoma -2.000 3.1e-03
oligodendroglioma -1.200 1.7e-02
psoriasis -1.600 7.3e-04
subependymal giant cell astrocytoma 2.272 2.5e-02

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTP      1 - 70
AIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMK     71 - 140
HTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKL    141 - 210
SEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNM    211 - 280
KRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLR    281 - 350
LQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK     351 - 419
//

Text Mined References (25)

PMID Year Title