Property Summary

Ligand Count 43
NCBI Gene PubMed Count 15
PubMed Score 0.24
PubTator Score 8.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Hypoxia 33 0.0 0.0
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 3.0
Disease Target Count Z-score Confidence
Hepatoerythropoietic porphyria 5 3.994 2.0
Choledocholithiasis 11 3.056 1.5

Expression

Gene RIF (2)

AA Sequence

MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWV      1 - 70
VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVC     71 - 140
LPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCM    141 - 210
GDSGGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAAN                     211 - 263
//

Text Mined References (16)

PMID Year Title