Property Summary

NCBI Gene PubMed Count 14
Grant Count 8
R01 Count 5
Funding $15,273,899.4
PubMed Score 0.89
PubTator Score 8.03

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
19844255 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWV      1 - 70
VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVC     71 - 140
LPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCM    141 - 210
GDSGGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAAN                     211 - 263
//

Text Mined References (15)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10713514 2000 Crystal structure of delta-chymotrypsin bound to a peptidyl chloromethyl ketone inhibitor.
8186414 1993 Genomic cloning and partial characterization of human chymotrypsinogen gene.
6983488 1982 Interaction of human alpha 1-proteinase inhibitor with chymotrypsinogen A and crystallization of a proteolytically modified alpha 1-proteinase inhibitor.
2917002 1989 Molecular cloning and nucleotide sequence of human pancreatic prechymotrypsinogen cDNA.
More...