Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.89
PubTator Score 8.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Expression

Synonym

Accession P17538
Symbols CTRB

Gene

PANTHER Protein Class (3)

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG

Gene RIF (1)

PMID Text
19844255 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWV      1 - 70
VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVC     71 - 140
LPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCM    141 - 210
GDSGGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAAN                     211 - 263
//

Text Mined References (15)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10713514 2000 Crystal structure of delta-chymotrypsin bound to a peptidyl chloromethyl ketone inhibitor.
8186414 1993 Genomic cloning and partial characterization of human chymotrypsinogen gene.
6983488 1982 Interaction of human alpha 1-proteinase inhibitor with chymotrypsinogen A and crystallization of a proteolytically modified alpha 1-proteinase inhibitor.
2917002 1989 Molecular cloning and nucleotide sequence of human pancreatic prechymotrypsinogen cDNA.
More...