Property Summary

NCBI Gene PubMed Count 87
PubMed Score 246.90
PubTator Score 327.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 8.75350844540266E-12
lung carcinoma 2844 1.36347540319983E-9
psoriasis 6685 3.26829578612225E-5
lung cancer 4473 7.98301910482324E-5
medulloblastoma, large-cell 6234 2.46367255497318E-4
atypical teratoid / rhabdoid tumor 4369 5.6201476573591E-4
glioblastoma 5572 0.00172624152380543
COPD 116 0.00407489930930257
Gaucher disease type 3 76 0.00527190648096934
ovarian cancer 8492 0.00728138176634249
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00824902223396401
medulloblastoma 1524 0.00849446151864307
ependymoma 2514 0.0117567851742771
Multiple myeloma 1328 0.0122642844046077
Polycystic Ovary Syndrome 335 0.0126576994564816
subependymal giant cell astrocytoma 2287 0.0128247906444367
active Crohn's disease 918 0.0227305708847407
gastric cancer 436 0.0403875618002105
Disease Target Count Z-score Confidence
Multiple Endocrine Neoplasia Type 1 30 4.624 2.3
Cancer 2346 4.142 2.1

Expression

  Differential Expression (18)

Disease log2 FC p
gastric cancer -1.900 0.040
Multiple myeloma 1.021 0.012
ependymoma 1.400 0.012
psoriasis -1.700 0.000
atypical teratoid / rhabdoid tumor 1.400 0.001
glioblastoma 1.500 0.002
medulloblastoma 1.500 0.008
medulloblastoma, large-cell 1.300 0.000
pancreatic ductal adenocarcinoma liver m... 1.452 0.008
non-small cell lung cancer -1.392 0.000
lung cancer -1.300 0.000
active Crohn's disease -1.413 0.023
subependymal giant cell astrocytoma -1.321 0.013
COPD -1.600 0.004
Polycystic Ovary Syndrome -1.033 0.013
lung carcinoma -1.100 0.000
ovarian cancer 1.200 0.007
Gaucher disease type 3 1.600 0.005

Synonym

Accession P17535 Q53EK9
Symbols AP-1

Gene

PANTHER Protein Class (1)

PDB

3U86  

  Ortholog (6)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (47)

PMID Text
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26305372 recombinant SERPINE2 induced a clear inhibition of MMP-13 expression in IL-1alpha-stimulated chondrocytes. This inhibitory effect is likely regulated through a pathway involving ERK 1/2, NF-kappaB and AP-1
25906693 miR-494 is a novel regulator of HNPC apoptosis induced by TNF-alpha
25788572 JunD activates miR-29b by enhancing its transcription and processing, which contribute to the inhibitory effect of JunD
24658685 Cells in contact with basement membrane undergo transient oscillations between two molecular states defined by their TGFBR3- JUND expression.
24551192 HIV-1 Vpu-expressing U937 monocytes coculture with LX2 stellate cells to activate release of transforming growth factor beta to culture supernatant, which correlates with increased activity of the AP-1 transcription factor
24140207 BAG3 stabilized JunD mRNA.
24038602 Binding of specific AP-1 factors, we found JunD associated with the LILRB1 distal promoter.
23942796 Jun proteins (pc-Jun and JunD) influence carcinogenesis and tumour progression, suggesting a significant role as prognostic predictors in human ovarian carcinoma.
23376981 This genotype-phenotype correlation study confirmed the lack of direct genotype-phenotype correlations. However, patients with mutations affecting the JunD interacting domain had a higher risk of death secondary to a MEN1 tumor
More...

AA Sequence

METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPP      1 - 70
TPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGF     71 - 140
VKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGA    141 - 210
ATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRI    211 - 280
AASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY       281 - 347
//

Text Mined References (92)

PMID Year Title
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26305372 2015 SERPINE2 Inhibits IL-1?-Induced MMP-13 Expression in Human Chondrocytes: Involvement of ERK/NF-?B/AP-1 Pathways.
25906693 2015 MicroRNA-494 inhibition protects nucleus pulposus cells from TNF-?-induced apoptosis by targeting JunD.
25788572 2015 JunD enhances miR-29b levels transcriptionally and posttranscriptionally to inhibit proliferation of intestinal epithelial cells.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24658685 2014 A time- and matrix-dependent TGFBR3-JUND-KRT5 regulatory circuit in single breast epithelial cells and basal-like premalignancies.
24647988 2014 Targeting androgen receptor and JunD interaction for prevention of prostate cancer progression.
24140207 2013 BAG3 is upregulated by c-Jun and stabilizes JunD.
24038602 2014 The AP-1 transcription factor JunD activates the leukocyte immunoglobulin-like receptor 1 distal promoter.
More...