Property Summary

NCBI Gene PubMed Count 92
PubMed Score 252.62
PubTator Score 327.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease -1.413 2.3e-02
atypical teratoid / rhabdoid tumor 1.400 5.6e-04
COPD -1.600 4.1e-03
ependymoma 1.400 1.2e-02
gastric cancer -1.900 4.0e-02
Gaucher disease type 3 1.500 4.6e-03
glioblastoma 1.200 6.4e-03
group 4 medulloblastoma 1.100 5.0e-02
lung cancer -1.300 8.0e-05
lung carcinoma -1.100 1.4e-09
medulloblastoma, large-cell 1.300 2.5e-04
Multiple myeloma 1.021 1.2e-02
non-small cell lung cancer -1.373 4.4e-11
ovarian cancer 1.200 7.3e-03
pancreatic ductal adenocarcinoma liver m... 1.452 8.2e-03
Polycystic ovary syndrome -1.033 1.3e-02
psoriasis -1.700 3.3e-05
subependymal giant cell astrocytoma -1.321 1.3e-02

Gene RIF (51)

AA Sequence

METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPP      1 - 70
TPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGF     71 - 140
VKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGA    141 - 210
ATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRI    211 - 280
AASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY       281 - 347
//

Text Mined References (97)

PMID Year Title