Property Summary

NCBI Gene PubMed Count 38
PubMed Score 51.39
PubTator Score 273.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.008 2.6e-03

Protein-protein Interaction (1)

Gene RIF (18)

AA Sequence

MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIA      1 - 70
DGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPLPKDENGKVIFD     71 - 140
TVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKSKD    141 - 210
IVLVAHSALGTQRHKLWVDPNSPVLLEDPVLCALAKKHKQTPALIALRYQLQRGVVVLAKSYNEQRIREN    211 - 280
IQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPFSDEY                               281 - 323
//

Text Mined References (40)

PMID Year Title