Property Summary

NCBI Gene PubMed Count 36
PubMed Score 42.47
PubTator Score 33.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
colon cancer 1475 1.39437438701485E-5
pancreatic cancer 2300 1.21822489554205E-4
ovarian cancer 8492 0.00264685372461853
fibroadenoma 557 0.0242883202932375
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0290539572861132
gastric carcinoma 832 0.0324081739501411
esophageal adenocarcinoma 737 0.0390499691410918
Disease Target Count Z-score Confidence
Hypospadias 65 3.522 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
esophageal adenocarcinoma 1.100 0.039
intraductal papillary-mucinous neoplasm ... 1.500 0.029
colon cancer 1.800 0.000
pancreatic cancer 1.200 0.000
fibroadenoma -1.300 0.024
gastric carcinoma 1.200 0.032
ovarian cancer 1.700 0.003

Synonym

Accession P17509 A8K835 D3DTV5 P09068 Q9HB11 Q9UGH2
Symbols HOX2
HU-2
HOX2B
Hox-2.2

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (4)

PMID Text
22603795 HOXB5, HOXB6, and HOXB7 are activated in Barrett esophagus, and the midcluster HOXB gene signature in BE most resembled the colon rather than other GI epithelia.
19477923 Data show that inducible Hox genes are selectively sensitive to the inhibition of actin polymerization and that actin polymerization is required for the assembly of a transcription complex on the regulatory region of the Hox genes.
17003840 Observational study of gene-disease association. (HuGE Navigator)
15269212 the homeodomain contains most or all of the important structures required for HOXB6 activity in blood cells.

AA Sequence

MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAA      1 - 70
PCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSS     71 - 140
SFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSA    141 - 210
SQLSAEEEEEKQAE                                                            211 - 224
//

Text Mined References (39)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22603795 2012 Evidence for a functional role of epigenetically regulated midcluster HOXB genes in the development of Barrett esophagus.
19477923 2009 Induction of HoxB transcription by retinoic acid requires actin polymerization.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17003840 2007 Mutation screening of BMP4, BMP7, HOXA4 and HOXB6 genes in Chinese patients with hypospadias.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...