Property Summary

NCBI Gene PubMed Count 36
PubMed Score 42.59
PubTator Score 33.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer 1.800 1.4e-05
esophageal adenocarcinoma 1.100 3.9e-02
fibroadenoma -1.300 2.4e-02
gastric carcinoma 1.200 3.2e-02
intraductal papillary-mucinous neoplasm ... 1.500 2.9e-02
ovarian cancer 1.700 2.6e-03
pancreatic cancer 1.200 1.2e-04

Gene RIF (4)

AA Sequence

MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAA      1 - 70
PCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSS     71 - 140
SFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSA    141 - 210
SQLSAEEEEEKQAE                                                            211 - 224
//

Text Mined References (39)

PMID Year Title