Property Summary

NCBI Gene PubMed Count 51
Grant Count 128
R01 Count 64
Funding $21,661,019.65
PubMed Score 156.10
PubTator Score 97.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession P17483 Q9NTA0
Symbols HOX2
HOX2F
HOX-2.6

Gene

Gene RIF (32)

PMID Text
26867567 The analysis of HOX expression in primary mesothelioma tumors indicated that these cells could also be sensitive to the disruption of HOX activity by HXR9, and that the expression of HOXB4 is strongly associated with overall survival
26202933 showed that OAC1 treatment led to OCT4-mediated upregulation of HOXB4
26166023 HOXA4 increases short-term repopulation to higher levels than HOXB4, which may involve Notch signaling to induce self-renewal of primitive hematopoietic cells
25996682 decreased methylation at HOXB3 and HOXB4 was associated with increased gene expression of both HOXB genes specific to the mid-risk AML, while increased DNA methylation at DCC distinctive to the high-risk AML was associated with increased gene expression
24859765 Epigenetic analysis revealed that increased promoter methylation of HOXB4 correlates with decreased expression of its transcript in oral cancer cell lines. HOXB4 may work as an epigenetic biomarker gene.
24810639 a crucial regulator of NK lytic function
23630040 Our study demonstrates for the first time the regulation of HOXB4 by miR-23a
23028422 GATA-2 directly regulates HOXB4 expression in hematopoietic stem cells, which may play an important role in the development and/or progression of aplastic anemia.
22761810 our results outline the effects of HOXB4 in combination with stromal cells in the development of NK cells from embryonic stem cells.
22664110 HOXB4-positivity as an independent predictor of overall survival of acute myeloid leukemia patients
More...

AA Sequence

MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAACTVQRYAACRD      1 - 70
PGPPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSPPPPPCAQNPLHPSPSHSACKEPV     71 - 140
VYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWF    141 - 210
QNRRMKWKKDHKLPNTKIRSGGAAGSAGGPPGRPNGGPRAL                                 211 - 251
//

Text Mined References (53)

PMID Year Title
26867567 2016 HOX transcription factors are potential targets and markers in malignant mesothelioma.
26202933 2016 Activation of OCT4 enhances ex vivo expansion of human cord blood hematopoietic stem and progenitor cells by regulating HOXB4 expression.
26166023 2015 HOXA4 provides stronger engraftment potential to short-term repopulating cells than HOXB4.
25996682 2015 Identification of differentially methylated markers among cytogenetic risk groups of acute myeloid leukemia.
24859765 2014 Epigenetic repression of HOXB cluster in oral cancer cell lines.
24810639 2014 Enhanced cytotoxic activity of ex vivo-differentiated human natural killer cells in the presence of HOXB4.
23630040 2013 Identification of the transcription factor HOXB4 as a novel target of miR-23a.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028422 2012 Gene expression profiling identifies HOXB4 as a direct downstream target of GATA-2 in human CD34+ hematopoietic cells.
22761810 2012 The HOXB4 homeoprotein promotes the ex vivo enrichment of functional human embryonic stem cell-derived NK cells.
More...