Property Summary

NCBI Gene PubMed Count 54
PubMed Score 159.67
PubTator Score 97.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

 GO Component (2)

Gene RIF (35)

AA Sequence

MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAACTVQRYAACRD      1 - 70
PGPPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSPPPPPCAQNPLHPSPSHSACKEPV     71 - 140
VYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWF    141 - 210
QNRRMKWKKDHKLPNTKIRSGGAAGSAGGPPGRPNGGPRAL                                 211 - 251
//

Text Mined References (56)

PMID Year Title