Property Summary

NCBI Gene PubMed Count 51
PubMed Score 33.58
PubTator Score 40.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
aldosterone-producing adenoma 1.043 1.8e-02
colon cancer 1.500 2.2e-03
medulloblastoma, large-cell 1.100 1.1e-03
osteosarcoma 1.005 9.3e-03

Gene RIF (26)

AA Sequence

MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHA      1 - 70
SGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLET     71 - 140
SAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYL    141 - 210
TRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE                                  211 - 250
//

Text Mined References (53)

PMID Year Title