Property Summary

NCBI Gene PubMed Count 46
Grant Count 2
Funding $80,891.53
PubMed Score 29.53
PubTator Score 40.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.005 0.009
medulloblastoma, large-cell 1.100 0.001
colon cancer 1.500 0.002
aldosterone-producing adenoma 1.043 0.018

Synonym

Accession P17482 B2RDB7 Q9H1I1
Symbols HOX2
HOX2E
HOX-2.5

Gene

 Grant Application (2)

Gene RIF (21)

PMID Text
26544896 Expression of GalNAc-T14 or HOXB9 was strongly correlated with reduced recurrence-free survival in lung adenocarcinomas.
26536658 the results of the present study suggested that HOXB9 is a tumor suppressor in gastric carcinoma, and its activity was controlled by different regulatory mechanisms such as the hexapeptide motif as a "brake" in this case
25860510 Knock-down of HOXB9 expression decreased migration, invasion and proliferation but did not alter adhesion.
25724625 Low HOXB9 expression promotes pancreatic ductal adenocarcinoma progression.
25136922 Identification of the transcription factor binding site of the HOXB9 promoter region suggests that E2F1 is a direct regulator of HOXB9 expression in breast cancer.
25081022 HOXB9 promotes epithelial-to-mesenchymal transition via TGF-beta1 pathway in hepatocellular carcinoma cells.
25025961 HOXB9 promoted colon adenocarcinoma differentiation.
24600698 rs2303486 may be associated with severity of developmental dysplaasia of the hip in Chinese Han females.
24582746 HOXB9 overexpression increased the tumorigenicity of glioma cells in vivo. Moreover, the activation of transforming growth factor-beta1 contributed to HOXB9-induced oncogenic activities.
24462859 Data show that the HOXB9 overexpression group had significantly shorter overall survival time than the HOXB9 downexpression group.
More...

AA Sequence

MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHA      1 - 70
SGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLET     71 - 140
SAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYL    141 - 210
TRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE                                  211 - 250
//

Text Mined References (47)

PMID Year Title
26544896 2015 GalNAc-T14 promotes metastasis through Wnt dependent HOXB9 expression in lung adenocarcinoma.
26536658 2015 HOXB9 induction of mesenchymal-to-epithelial transition in gastric carcinoma is negatively regulated by its hexapeptide motif.
25860510 2015 The role of HOXB9 and miR-196a in head and neck squamous cell carcinoma.
25724625 2015 Kindlin-2 induced by TGF-? signaling promotes pancreatic ductal adenocarcinoma progression through downregulation of transcriptional factor HOXB9.
25416956 2014 A proteome-scale map of the human interactome network.
25136922 2014 An E2F1-HOXB9 transcriptional circuit is associated with breast cancer progression.
25081022 2015 HOXB9 promotes epithelial-to-mesenchymal transition via transforming growth factor-?1 pathway in hepatocellular carcinoma cells.
25025961 2014 Elevated HOXB9 expression promotes differentiation and predicts a favourable outcome in colon adenocarcinoma patients.
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24600698 2014 Association of a single nucleotide polymorphism in HOXB9 with developmental dysplasia of the hip: a case-control study.
More...