Property Summary

NCBI Gene PubMed Count 73
Grant Count 73
R01 Count 51
Funding $9,811,862.12
PubMed Score 197.12
PubTator Score 160.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.422 0.000
group 4 medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.200 0.000

Synonym

Accession P17480 A8K6R8
Symbols UBF
UBF1
UBF2
UBF-1
NOR-90

Gene

PDB

1K99   1L8Y   1L8Z   2HDZ  

Gene RIF (29)

PMID Text
25965800 These results suggest that UBF can inhibit gene expression from viral DNA prior to its replication.
25890091 This study provides some compelling evidences in support of HBx-elicited and c-Myc-mediated increase in UBF levels that abets oncogenic onslaught in hepatic cells by increasing rDNA transcription and ribosome biogenesis.
25452314 we have uncovered a novel role for UBTF1 and UBTF2 in maintaining genome stability through coordinating the expression of highly transcribed Pol I (UBTF1 activity) and Pol II genes (UBTF2 activity).
24798431 p14ARF fails to prevent E7-mediated UBF1 phosphorylation, but could facilitate nucleolar pRb inactivation by targeting E7 to the nucleolus.
23591814 PIP2 depletion reduces Pol I transcription.
22393235 Downregulation of RUNX2 expression reduces the localization of HDAC1 to the nucleolar periphery and also decreases the association between HDAC1 and UBF.
21177859 hALP binds the upstream binding factor (UBF) in vivo and in vitro
21162312 UBF is expressed widely by human multiple fetal tissue,s and the expression level is very high in HL-60 cells.
20713446 depletion of upstream binding factor (UBF; an rRNA transcription factor) decreased the chromatin binding affinity of B23, which in turn led to an increase in histone density at the r-chromatin
19527688 central repeated domain of treacle binds with RNA polymerase I, while that the treacle C-terminus is involved in rDNA promoter recognition and UBF recruitment.
More...

AA Sequence

MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKL      1 - 70
KWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNL     71 - 140
DLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHE    141 - 210
KKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKS    211 - 280
TLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQK    281 - 350
KKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEE    351 - 420
KRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREERGKLPESPKRAEE    421 - 490
IWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKK    491 - 560
MKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHL    561 - 630
DLWVKSLSPQDRAAYKEYISNKRKSMTKLRGPNPKSSRTTLQSKSESEEDDEEDEDDEDEDEEEEDDENG    631 - 700
DSSEDGGDSSESSSEDESEDGDENEEDDEDEDDDEDDDEDEDNESEGSSSSSSSSGDSSDSDSN          701 - 764
//

Text Mined References (85)

PMID Year Title
26089203 2015 The Warsaw breakage syndrome-related protein DDX11 is required for ribosomal RNA synthesis and embryonic development.
25965800 2015 Upstream binding factor inhibits herpes simplex virus replication.
25890091 2015 The HBx oncoprotein of hepatitis B virus potentiates cell transformation by inducing c-Myc-dependent expression of the RNA polymerase I transcription factor UBF.
25452314 2015 A novel role for the Pol I transcription factor UBTF in maintaining genome stability through the regulation of highly transcribed Pol II genes.
24798431 2014 Human papillomavirus 16 oncoprotein E7 stimulates UBF1-mediated rDNA gene transcription, inhibiting a p53-independent activity of p14ARF.
23591814 2013 Involvement of phosphatidylinositol 4,5-bisphosphate in RNA polymerase I transcription.
23229552 2013 PHF6 regulates cell cycle progression by suppressing ribosomal RNA synthesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...