Property Summary

Ligand Count 7
NCBI Gene PubMed Count 64
PubMed Score 195.55
PubTator Score 149.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.100 9.6e-03
Breast cancer 1.500 5.4e-03
breast carcinoma -1.500 2.8e-02
colon cancer -1.800 2.5e-04
cystic fibrosis -4.263 1.1e-07
ductal carcinoma in situ -2.100 9.2e-03
group 3 medulloblastoma 2.000 1.9e-04
intraductal papillary-mucinous adenoma (... -2.000 1.0e-04
intraductal papillary-mucinous carcinoma... -1.900 6.2e-04
invasive ductal carcinoma -2.700 5.8e-03
lung adenocarcinoma -1.500 2.8e-10
lung cancer 1.100 1.6e-02
lung carcinoma -2.200 7.1e-15
malignant mesothelioma -1.100 6.9e-04
medulloblastoma, large-cell 1.300 2.2e-02
non diabetic and post-ischemic heart fai... 1.100 4.9e-03
non-small cell lung carcinoma -1.600 1.2e-24
osteosarcoma -1.034 3.8e-02
ovarian cancer 1.500 9.6e-04
pancreatic cancer 1.300 4.7e-04
periodontitis -1.300 1.3e-25
psoriasis 1.400 1.1e-02
type II diabetes mellitus and post-ische... 1.400 3.4e-02
X-linked recessive Emery-Dreifuss muscul... 1.258 3.2e-03

Gene RIF (44)

AA Sequence

MPSLLVLTFSPCVLLGWALLAGGTGGGGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLPQDDSYLFSLT      1 - 70
RVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA     71 - 140
APVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLE    141 - 210
RNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMT    211 - 280
SGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNM    281 - 350
EDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIA    351 - 420
MTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSSGGLEESAVTGIVVG    421 - 490
ALLGAGLLMAFYFFRKKYRITIERRTQQEESNLGKHRELREDSIRSHFSVA                       491 - 541
//

Text Mined References (65)

PMID Year Title