Property Summary

NCBI Gene PubMed Count 62
Grant Count 217
R01 Count 44
Funding $338,969,919.65
PubMed Score 186.36
PubTator Score 149.57

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P17342 A2RRD1 B4DT84 E7EPG9
Symbols NPRC
ANP-C
ANPRC
NPR-C
ANPR-C
GUCY2B
C5orf23

Gene

PANTHER Protein Class (3)

PDB

1YK0   1YK1   1JDP   1JDN  

Gene RIF (42)

PMID Text
26345810 This study focused on the natriuretic peptide receptor C gene (NPR3). The correlation analysis between NPR3 and hypertension was replicated in 450 Chinese Dai and 484 Chinese Mongolian individuals.
25736855 Results from this study point to a role for miR-100 in the regulation of NPR3 expression, and suggest a possible therapeutic target for modulation of NP bioactivity in heart disease.
25711724 Angiotensin II downregulates vascular smooth muscle cell NPR-C gene expression by destabilizing its mRNA.
24667918 Microarray analysis indicates HIV-1 Tat-induced downregulation of natriuretic peptide receptor 3 (NPR3) in primary human brain microvascular endothelial cells
24465655 Data show that natriuretic peptide receptor 3 (NPR3) single nucleotide polymorphism (SNP) is independently associated with diastolic dysfunction and does not appear to be related to alterations in circulating levels of natriuretic peptides.
23493048 The significant change in NPR3 protein was observed for the Arg146 variant allozyme, with 20% of wild-type protein, primarily because of autophagy-dependent degradation.
22995222 a NPR3 promoter gene variant could have a role on cerebrovascular disease susceptibility
22559095 polymorphisms or haplotype in NPR3 gene may influence the risk of ischemic stroke or hypertension independently in Chinese population.
22421372 Report the presence of CNP and its receptors, NPR2/3 in atherosclerotic plaques of human carotid artery, with increased expression of NPR3 in histologically unstable plaques.
22001395 Results demonstrate the opposite effects of NPR-A and NPR-C in LPS-mediated endothelial permeability and lung injury.
More...

AA Sequence

MPSLLVLTFSPCVLLGWALLAGGTGGGGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLPQDDSYLFSLT      1 - 70
RVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA     71 - 140
APVARLASHWDLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLE    141 - 210
RNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMT    211 - 280
SGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNM    281 - 350
EDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIA    351 - 420
MTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSSGGLEESAVTGIVVG    421 - 490
ALLGAGLLMAFYFFRKKYRITIERRTQQEESNLGKHRELREDSIRSHFSVA                       491 - 541
//

Text Mined References (63)

PMID Year Title
26345810 2015 Correlation between natriuretic peptide receptor C (NPR3) gene polymorphisms and hypertension in the Dai people of China.
25736855 2015 Natriuretic peptide receptor 3 (NPR3) is regulated by microRNA-100.
25711724 2015 Downregulation of natriuretic peptide clearance receptor mRNA in vascular smooth muscle cells by angiotensin II.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24465655 2014 A functional genetic variant (N521D) in natriuretic peptide receptor 3 is associated with diastolic dysfunction: the prevalence of asymptomatic ventricular dysfunction study.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23493048 2013 Natriuretic peptide receptor-3 gene (NPR3): nonsynonymous polymorphism results in significant reduction in protein expression because of accelerated degradation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22995222 2013 Association of a single nucleotide polymorphism of the NPR3 gene promoter with early onset ischemic stroke in an Italian cohort.
More...