Property Summary

NCBI Gene PubMed Count 448
Grant Count 1,027
R01 Count 735
Funding $160,778,569.41
PubMed Score 3888.36
PubTator Score 1729.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (64)

Disease Z-score Confidence
Oculodentodigital dysplasia 14 7.195 3.6
Heart disease 279 5.601 2.8
Myocardial Infarction 126 4.989 2.5
Cancer 2,346 4.688 2.3
Syndactyly 56 4.503 2.3
Erythrokeratodermia variabilis 10 3.66 1.8
Palmoplantar keratosis 36 3.648 1.8
Dental enamel hypoplasia 12 3.379 1.7
Hypertension 287 3.3 1.7
Clouston syndrome 9 3.278 1.6
Epilepsy 346 3.204 1.6
Cerebrovascular disease 231 3.046 1.5
ATRIOVENTRICULAR SEPTAL DEFECT 3 1
Adenoma 165
Alopecia congenita keratosis palmoplanta... 1 
Atrioventricular septal defect and commo... 1 
Autistic Disorder 320
Becker muscular dystrophy 187
Breast cancer 3,094
Cardiac Arrhythmia 20
Cataract 104 4.0
Coronary aneurysm 4
Craniometaphyseal dysplasia, autosomal r... 1 
Diaphragmatic Hernia 40
Down syndrome 548
Duchenne muscular dystrophy 602
Hallermann's Syndrome 1
Hypertensive disease 193
Hypoplastic left heart syndrome 5
Hypotrichosis 29 4.0
Lung Neoplasms 171
Myocardial Reperfusion Injury 34
Oculo-dento-digital syndrome 1
Oculodentodigital Dysplasia, Autosomal R... 1 
PALMOPLANTAR KERATODERMA AND CONGENITAL ... 1 
Prostatic Neoplasms 471
SYNDACTYLY, TYPE III 1
Skin Neoplasms 49
active ulcerative colitis 477
acute quadriplegic myopathy 1,157
aldosterone-producing adenoma 664
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
dermatomyositis 933
diabetes mellitus 1,663
gastric carcinoma 832
group 4 medulloblastoma 1,875
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pituitary cancer 1,972
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031

Expression

Synonym

Accession P17302 B2R5U9 Q6FHU1 Q9Y5I8
Symbols HSS
CMDR
CX43
EKVP
GJAL
ODDD
AVSD3
HLHS1
PPKCA

Gene

PANTHER Protein Class (2)

PDB

2LL2  

Gene RIF (391)

PMID Text
26902399 high glucose disassociated interactions between Cx43 and tight junctions, and then increased airway epithelial transepithelial electrical resistance and permeability by down-regulation of Cx43 in human airway epithelial cells.
26869446 Increased membrane permeability induced by linoleic acid is mediated by an intracellular signaling pathway activated by GPR40 that leads to an increase in membrane levels of Cx43 phosphorylated at serine 373 via Akt.
26823747 Report expression of connexin 43 in ovarian cancer cells in G1/S phase.
26784020 Connexin 43 significantly regulates osteogenic differentiation in the cells from posterior longitudinal ligament by altering the activity of ERK, and subsequently causing the modification of Runx2.
26586821 The results of this study showed that in the olfactory bulb, connexin 43 hemichannel function is promoted by neuronal activity and modulates neuronal network slow oscillations.
26543049 Stage of labour effected uterine expression of phosphorylated form
26517241 Cx43 expressed by mesenchymal stem cells induces apoptosis on leukemia cells.
26491675 AR pathway plays an important role in regulation of CX43 expression in prostate cancer cells. AR may be the upstream signal of CX43.
26481195 Cx43-Hsc70 interaction regulates cell cycle G1/S progression through a novel mechanism by which Cx43-Hsc70 interaction prevents the nuclear accumulation of p27 through controlling the nuclear translocation of cyclin D1-CDK4-p27 complex.
26450928 we are the first to identify that miR-381 suppresses C/EBPalpha-dependent Cx43 expression in breast cancer cells. The miR-381-C/EBPalpha-Cx43 axis might be a useful diagnostic and therapeutic target of metastatic breast cancer
More...

AA Sequence

MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSF      1 - 70
PISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE     71 - 140
EHGKVKMRGGLLRTYIISILFKSIFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFI    141 - 210
IFMLVVSLVSLALNIIELFYVFFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSP    211 - 280
MSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAG    281 - 350
HELQPLAIVDQRPSSRASSRASSRPRPDDLEI                                          351 - 382
//

Text Mined References (461)

PMID Year Title
26902399 2016 High glucose induces dysfunction of airway epithelial barrier through down-regulation of connexin 43.
26869446 2016 Linoleic acid permeabilizes gastric epithelial cells by increasing connexin 43 levels in the cell membrane via a GPR40- and Akt-dependent mechanism.
26823747 2015 Roles of Cx43 and AKAP95 in ovarian cancer tissues in G1/S phase.
26784020 2016 Connexin 43 Affects Osteogenic Differentiation of the Posterior Longitudinal Ligament Cells via Regulation of ERK Activity by Stabilizing Runx2 in Ossification.
26586821 2015 Astroglial Connexin 43 Hemichannels Modulate Olfactory Bulb Slow Oscillations.
26543049 2016 Modelling maternal obesity: the effects of a chronic high-fat, high-cholesterol diet on uterine expression of contractile-associated proteins and ex vivo contractile activity during labour in the rat.
26517241 2015 Increased expression of CX43 on stromal cells promotes leukemia apoptosis.
26491675 2015 AR Pathway Is Involved in the Regulation of CX43 in Prostate Cancer.
26481195 2015 Interaction of Cx43 with Hsc70 regulates G1/S transition through CDK inhibitor p27.
26450928 2015 miR-381 suppresses C/EBP?-dependent Cx43 expression in breast cancer cells.
More...