Property Summary

NCBI Gene PubMed Count 377
PubMed Score 335.86
PubTator Score 292.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.500 8.8e-03
atypical teratoid / rhabdoid tumor 1.400 6.0e-05
Breast cancer 2.700 2.9e-02
cystic fibrosis 1.864 8.6e-05
ependymoma 2.200 1.1e-06
glioblastoma 1.900 2.1e-05
intraductal papillary-mucinous carcinoma... 2.700 9.7e-03
intraductal papillary-mucinous neoplasm ... 3.700 8.8e-03
lung carcinoma -2.400 2.0e-20
malignant mesothelioma -3.000 8.9e-09
non-small cell lung cancer 1.031 6.1e-08
osteosarcoma 1.939 1.5e-02
ovarian cancer -1.400 3.2e-03
pancreatic cancer 1.400 3.4e-06
primary pancreatic ductal adenocarcinoma 2.813 2.3e-04
primitive neuroectodermal tumor 2.200 4.3e-03
progressive supranuclear palsy -1.300 4.1e-02
ulcerative colitis 1.500 4.3e-05

Gene RIF (327)

AA Sequence

MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWS      1 - 70
GFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILTRNMGTGGFLTCGPLWAQQCG     71 - 140
NQYYTTGVCSDISPDFQLSASFSPATQPCPSLIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQ    141 - 210
VGLIQYANNPRVVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVV    211 - 280
VTDGESHDGSMLKAVIDQCNHDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAAL    281 - 350
LEKAGTLGEQIFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP    351 - 420
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQAHRGDQIGSY    421 - 490
FGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEGRVYLFTIKKGILGQHQFLEGPEGIENTRFGSAIAA    491 - 560
LSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKYSQKILGSDGAFRSHLQYFGRSLDGYGDLNG    561 - 630
DSITDVSIGAFGQVVQLWSQSIADVAIEASFTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNI    631 - 700
TLDADGFSSRVTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPA    701 - 770
LEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTG    771 - 840
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQNLQNQASLSF    841 - 910
QALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIVHSFEDVGPKFIFSLKVTTG    911 - 980
SVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCNADINPLKIGQTSSSVSFKSENFRHTKELNC    981 - 1050
RTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLM   1051 - 1120
IMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS            1121 - 1181
//

Text Mined References (386)

PMID Year Title