Property Summary

NCBI Gene PubMed Count 361
Grant Count 303
R01 Count 134
Funding $39,782,507.21
PubMed Score 11812.98
PubTator Score 292.99

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P17301 Q14595
Symbols BR
GPIa
CD49B
HPA-5
VLA-2
VLAA2

Gene

PDB

4BJ3   1AOX   1DZI   1PQB   1V7P  

 IMPC Term (1)

Gene RIF (311)

PMID Text
26927558 Data indicate that in recurrent spontaneous abortion patients, the expression levels of CD49b and LAG-3 (CD223) on CD14(+) mononuclear cells and the plasma level of transforming growth factor beta (TGF-beta) decreased obviously compared with normal females.
26850110 PFL-mediated downregulation of integrin and EGFR contributes to the inhibition of tumor growth in vitro and in vivo. This novel anti-cancer mechanism of PFL suggests that this lectin would be useful as an anti-cancer drug or an adjuvant for other drugs.
26779610 Integrin alpha 2 and alpha 4 Yxxphi motifs interact with the endocytic clathrin adaptor, AP2 complex.
26408663 blockade of alpha2beta1 integrin with a neutralizing mAb inhibited IL-7-induced bone loss and osteoclast numbers by reducing Th17 cell numbers in the bone marrow
26304618 The Glycoprotein Ia C807T polymorphism might be a risk factor for the development and relapse of Acute Coronary Syndrome
26258411 Epigenetic silencing of ITGA2 by MiR-373 promotes cell migration in breast cancer.
26152212 Current review discusses the mechanisms by which integrin is activated and subsequently deactivated by focusing on its structure-function relationship
26051322 HRG binds to alpha2 integrin through low-affinity interactions in a heparin sulfate-independent manner, thereby blocking endothelial cells adhesion to collagen I.
25966234 Polymorphism of HPA- 5 is probably a risk factor for carotid atherosclerosis complicating T2DM.
25658015 CD34 and CD49b are cell surface markers that can be used to enrich a subpopulation of leiomyoma cells possessing stem/progenitor cell properties.
More...

AA Sequence

MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWS      1 - 70
GFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILTRNMGTGGFLTCGPLWAQQCG     71 - 140
NQYYTTGVCSDISPDFQLSASFSPATQPCPSLIDVVVVCDESNSIYPWDAVKNFLEKFVQGLDIGPTKTQ    141 - 210
VGLIQYANNPRVVFNLNTYKTKEEMIVATSQTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVV    211 - 280
VTDGESHDGSMLKAVIDQCNHDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAAL    281 - 350
LEKAGTLGEQIFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP    351 - 420
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQAHRGDQIGSY    421 - 490
FGSVLCSVDVDKDTITDVLLVGAPMYMSDLKKEEGRVYLFTIKKGILGQHQFLEGPEGIENTRFGSAIAA    491 - 560
LSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTIRTKYSQKILGSDGAFRSHLQYFGRSLDGYGDLNG    561 - 630
DSITDVSIGAFGQVVQLWSQSIADVAIEASFTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNI    631 - 700
TLDADGFSSRVTSRGLFKENNERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPA    701 - 770
LEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTG    771 - 840
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQNLQNQASLSF    841 - 910
QALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIVHSFEDVGPKFIFSLKVTTG    911 - 980
SVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCNADINPLKIGQTSSSVSFKSENFRHTKELNC    981 - 1050
RTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLM   1051 - 1120
IMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS            1121 - 1181
//

Text Mined References (370)

PMID Year Title
26927558 2016 [Decreased expression levels of LAG-3 and CD49b on CD14+ cells in peripheral blood of patients with recurrent spontaneous abortion].
26850110 2016 High mannose-binding Pseudomonas fluorescens lectin (PFL) downregulates cell surface integrin/EGFR and induces autophagy in gastric cancer cells.
26779610 2016 Selective integrin endocytosis is driven by interactions between the integrin ?-chain and AP2.
26408663 2015 Cooperation between IL-7 Receptor and Integrin ?2?1 (CD49b) Drives Th17-Mediated Bone Loss.
26304618 2015 Glycoprotein Ia C807T: Polymorphisms and Their Association with Platelet Function in Patients with the Acute Coronary Syndrome.
26258411 2015 Epigenetic silencing of ITGA2 by MiR-373 promotes cell migration in breast cancer.
26152212 2015 Structural basis of blocking integrin activation and deactivation for anti-inflammation.
26051322 2015 Histidine-rich glycoprotein blocks collagen-binding integrins and adhesion of endothelial cells through low-affinity interaction with ?2 integrin.
25966234 2015 Correlation between polymorphism of platelet alloantigen genes HPA-1-5 and type 2 diabetes complication by carotid atherosclerosis in a Chinese population.
25808196 2015 Intensified antineoplastic effect by combining an HDAC-inhibitor, an mTOR-inhibitor and low dosed interferon alpha in prostate cancer cells.
More...