Property Summary

Ligand Count 221
NCBI Gene PubMed Count 701
PubMed Score 226.81
PubTator Score 1382.62

Knowledge Summary

Patent (177,730)

TINX Plot

  Disease (6)

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.970 1.0e-02
aldosterone-producing adenoma -1.488 2.2e-02
astrocytoma 1.200 5.0e-02
atypical teratoid / rhabdoid tumor -2.500 8.8e-05
Breast cancer -2.000 3.2e-08
Common variable immunodeficiency -1.500 7.2e-03
glioblastoma -1.300 4.6e-03
group 3 medulloblastoma -3.200 6.4e-05
intraductal papillary-mucinous adenoma (... 1.200 3.7e-03
intraductal papillary-mucinous carcinoma... 1.500 5.1e-03
intraductal papillary-mucinous neoplasm ... 1.700 6.8e-03
invasive ductal carcinoma -1.900 4.0e-04
lung adenocarcinoma 1.200 3.0e-03
lung cancer -1.800 1.5e-02
lung carcinoma -1.300 8.1e-08
medulloblastoma, large-cell -4.100 4.9e-05
mucosa-associated lymphoid tissue lympho... 1.199 6.4e-03
ovarian cancer -2.900 9.6e-06
primitive neuroectodermal tumor -1.600 4.0e-02
psoriasis -1.300 7.5e-09
spina bifida 1.427 4.6e-02
tuberculosis 1.100 1.6e-04

 OMIM Phenotype (1)

Protein-protein Interaction (11)

Gene RIF (459)

AA Sequence

MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVC      1 - 70
CFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVH     71 - 140
KQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQ    141 - 210
KTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQ    211 - 280
EEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSF    281 - 350
GKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV    351 - 420
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMM    421 - 490
DGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKS    491 - 560
LSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFF    561 - 630
TRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV                                631 - 672
//

Text Mined References (726)

PMID Year Title