Property Summary

NCBI Gene PubMed Count 668
Grant Count 449
R01 Count 306
Funding $50,941,409.78
PubMed Score 212.15
PubTator Score 1382.62

Knowledge Summary

Patent (177,730)

Expression

Synonym

Accession P17252 B5BU22 Q15137 Q32M72 Q96RE4 PKC-A
Symbols AAG6
PKCA
PRKACA
PKC-alpha

Gene

PDB

2ELI   3IW4   4DNL   4RA4  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (429)

PMID Text
26826385 High P-PKCalpha expression in neoplastic gastric cancer biopsy samples as compared to nonneoplastic samples suggests that P-PKCalpha might act as an indicator of gastric cancer progression.
26769967 Prolonged membrane association/activation of PKCalpha is seen in self-renewing epithelium of the intestine, cervix, and skin.
26676968 RNA sequencing identified a novel ATPase, Ca2+ transporting, plasma membrane 4(ATP2B4)-protein kinase C-alpha (PRKCA) fusion transcript.
26671581 This study showed that SLC44A1-PRKCA fusion seems to be a specific characteristic of Papillary glioneuronal tumors with a high diagnostic value.
26662512 Kinocilium is essential for proper localization of Lgn, as well as Gai and aPKC, suggesting that cilium function plays a role in positioning of apical proteins critical for hearing.
26657401 Data show that bisindolylmaleimides (BIMs) Ro 31-8220 also blocks activity of the solute carrier organic cation transporter 1 (OCT1), involved in uptake of marketed drugs in the liver, in a protein kinase C (PKC)-independent manner.
26542395 PKCalpha is coupled to ATP-stimulated TMEM16A activation in biliary epithelial cells.
26398575 InB may exhibit growth-inhibitory activity through the activation of PKCalpha, followed by an increase in NFAT transactivation ability.
26350262 PKCalpha Attenuates Jagged-1-Mediated Notch Signaling in ErbB-2-Positive Breast Cancer to Reverse Trastuzumab Resistance
26304124 lipids mediate post-transcriptional regulation of HAMP through PKC- and HuR-dependent mechanisms
More...

AA Sequence

MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVC      1 - 70
CFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVH     71 - 140
KQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQ    141 - 210
KTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQ    211 - 280
EEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSF    281 - 350
GKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV    351 - 420
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMM    421 - 490
DGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKS    491 - 560
LSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFF    561 - 630
TRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV                                631 - 672
//

Text Mined References (692)

PMID Year Title
26826385 2016 Cobalt chloride-mediated protein kinase C? (PKC?) phosphorylation induces hypoxia-inducible factor 1? (HIF1?) in the nucleus of gastric cancer cell.
26769967 2016 Protein Kinase C? (PKC?) Is Resistant to Long Term Desensitization/Down-regulation by Prolonged Diacylglycerol Stimulation.
26676968 2016 Pigment-Synthesizing Melanocytic Neoplasm With Protein Kinase C Alpha (PRKCA) Fusion.
26671581 2015 Papillary glioneuronal tumors: histological and molecular characteristics and diagnostic value of SLC44A1-PRKCA fusion.
26662512 2016 The GPSM2/LGN GoLoco motifs are essential for hearing.
26657401 2015 Protein Kinase C-Independent Inhibition of Organic Cation Transporter 1 Activity by the Bisindolylmaleimide Ro 31-8220.
26542395 2016 PKC? regulates TMEM16A-mediated Cl? secretion in human biliary cells.
26398575 2015 Protein kinase C?-mediated cytotoxic activity of ineupatorolide B from Inula cappa DC. in HeLa cells.
26350262 2016 PKC? Attenuates Jagged-1-Mediated Notch Signaling in ErbB-2-Positive Breast Cancer to Reverse Trastuzumab Resistance.
26304124 2015 Saturated fatty acids induce post-transcriptional regulation of HAMP mRNA via AU-rich element-binding protein, human antigen R (HuR).
More...