Property Summary

NCBI Gene PubMed Count 59
Grant Count 45
R01 Count 16
Funding $3,983,664.64
PubMed Score 358.40
PubTator Score 416.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -6.695 0.000
mucosa-associated lymphoid tissue lympho... 4.636 0.011

 GO Function (1)

Gene RIF (45)

PMID Text
26228368 Bactericidal permeability increasing protein Lys216Glu polymorphism is associated with both Crohn's disease and ulcerative colitis.
26107902 MPO and BPI in CD4(+)T-lymphocytes, and PDHA1 and MRPL42 in CD8(+) T-lymphocytes might be used as specific biomarkers of severe asthma progression.
23626859 Diminished PRRs, IFN-signature, and BPI gene expression raises the possibility that impairments in these pathways contribute to the susceptibility of LBW term infants to infection.
23346184 Lung function and IgA-BPI-ANCA, but not Leeds criteria, were significantly associated with adverse outcome.
22409502 BPI mutation (PstI in intron 5) and a decreased plasma BPI level were significant risk factors in susceptibility to COPD...BPI genetic mutation and impaired BPI production or release may result in airflow obstruction in smokers.
21787345 The bactericidal/permeability-increasing protein in the innate defence of the lower airways
21463973 there is a correlation between the presence of BPI-ANCA, the properties of the colonizing bacteria and the clinical conditions of the host in cystic fibrosis
21272798 SNP Lys216Glu is associated with Crohn's disease and ulcerative colities
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20541026 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRENMARGPCNAPRWASLMVLVAIGTAVTAAVNPGVVVRISQKGLDYASQQGTAALQKELKRIKIPDYSD      1 - 70
SFKIKHLGKGHYSFYSMDIREFQLPSSQISMVPNVGLKFSISNANIKISGKWKAQKRFLKMSGNFDLSIE     71 - 140
GMSISADLKLGSNPTSGKPTITCSSCSSHINSVHVHISKSKVGWLIQLFHKKIESALRNKMNSQVCEKVT    141 - 210
NSVSSELQPYFQTLPVMTKIDSVAGINYGLVAPPATTAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAA    211 - 280
HDRMVYLGLSDYFFNTAGLVYQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVS    281 - 350
ASTPPHLSVQPTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELK    351 - 420
HSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLFGADVVYK       421 - 487
//

Text Mined References (64)

PMID Year Title
26228368 Bactericidal permeability increasing protein gene polymorphism is associated with inflammatory bowel diseases in the Turkish population.
26107902 [Comparative analysis of the role of CD4(+) and CD8(+) T cells in severe asthma development].
23626859 2013 Decreased pattern recognition receptor signaling, interferon-signature, and bactericidal/permeability-increasing protein gene expression in cord blood of term low birth weight human newborns.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23346184 2012 BPI-ANCA and long-term prognosis among 46 adult CF patients: a prospective 10-year follow-up study.
22409502 2012 The role of bactericidal/permeability-increasing protein in men with chronic obstructive pulmonary disease.
21787345 2011 The bactericidal/permeability-increasing protein (BPI) in the innate defence of the lower airways.
21463973 2011 Pseudomonas aeruginosa in cystic fibrosis: pyocyanin negative strains are associated with BPI-ANCA and progressive lung disease.
21272798 2011 Association between bactericidal/permeability increasing protein (BPI) gene polymorphism (Lys216Glu) and inflammatory bowel disease.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
More...