Tclin | Interferon alpha/beta receptor 1 |
Component of the receptor for type I interferons, including interferons alpha, IFNB1 and IFNW1 (PubMed:2153461, PubMed:7665574, PubMed:10049744, PubMed:14532120, PubMed:15337770, PubMed:21854986). Functions in general as heterodimer with IFNAR2 (PubMed:7665574, PubMed:10049744, PubMed:21854986). Type I interferon binding activates the JAK-STAT signaling cascade, and triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and the IFNR alpha- and beta-subunits themselves (PubMed:7665574, PubMed:21854986). Can form an active IFNB1 receptor by itself and activate a signaling cascade that does not involve activation of the JAK-STAT pathway (By similarity).
The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor. [provided by RefSeq, Jul 2008]
The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Down syndrome | 548 |
Muscle Weakness | 92 |
Virus Diseases | 2 |
Disease | Target Count |
---|---|
Chronic hepatitis C | 12 |
Chronic type B viral hepatitis | 2 |
Relapsing remitting multiple sclerosis | 14 |
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8492 | 3.93520299785316E-14 |
medulloblastoma, large-cell | 6234 | 1.04584416869461E-5 |
hepatocellular carcinoma | 550 | 1.83334185413972E-5 |
osteosarcoma | 7933 | 1.75993429252569E-4 |
psoriasis | 6685 | 5.60187210096222E-4 |
pancreatic ductal adenocarcinoma liver metastasis | 1795 | 7.9050398668611E-4 |
pancreatic cancer | 2300 | 0.00163443647113059 |
pancreatic carcinoma | 567 | 0.00163443647113059 |
tuberculosis and treatment for 6 months | 686 | 0.00652941840906959 |
Disease | log2 FC | p |
---|---|---|
hepatocellular carcinoma | 1.200 | 0.000 |
pancreatic cancer | 1.500 | 0.002 |
psoriasis | 1.100 | 0.001 |
osteosarcoma | -1.405 | 0.000 |
medulloblastoma, large-cell | -1.800 | 0.000 |
pancreatic ductal adenocarcinoma liver m... | -1.999 | 0.001 |
tuberculosis and treatment for 6 months | -1.500 | 0.007 |
pancreatic carcinoma | 1.500 | 0.002 |
ovarian cancer | -2.000 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG |
Dog | OMA Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG |
PMID | Text |
---|---|
26787880 | data illustrate a lipid G-protein coupled receptor (GPCR)-IFNAR1 regulatory loop that balances effective and detrimental immune responses and elevated endogenous S1PR1 signaling |
26679999 | Data suggest IFNA2 (interferon, alpha 2) binding to extracellular domain of IFNAR1 or IFNAR2 promotes proximity between intracellular domains; signaling depends on duration of activation/affinity of binding rather than specific conformational changes. |
26679744 | rs2843710 of IFNAR1 was associated with the susceptibility and severity of EV71 HFMD in Chinese Han populations. |
26676772 | These findings suggest that influenza A virus hemagglutinin causes IFNAR1 degradation, which in turn helps the virus escape the powerful innate immune system. |
26159719 | Prolidase was required for IFNAR1 maturation and accumulation, activation of IFNbeta-stimulated gene induction, and IFN-I-dependent viral control. |
26008745 | Dimerization of IFNAR1 and IFNAR2 and the limiting role of IFNAR1 binding affinity in complex assembly is modulated by USP18. |
25939635 | Genetic polymorphisms of the promoter of INFAR gene represent important factors associated with the clinical phase of HBeAg-negative chronic HBV infection. |
25675103 | IFNL4 and IFNL3 associated polymorphisms strongly influence the spontaneous IFN-alpha receptor-1 expression in HCV-infected patients |
25501140 | sequence variants of both the IFNAR1-17470 and IL-10-592 genes were correlated with susceptibility to chronic hepatitis B. |
25445652 | Results show that SNPs in IFNAR1 and IFNG were risk factors for malaria in Indian population. |
More... |
MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGM 1 - 70 DNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDK 71 - 140 AIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRHKIYKLSPETTYCLKVKAALLTSW 141 - 210 KIGVYSPVHCIKTTVENELPPPENIEVSVQNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQI 211 - 280 PDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYI 281 - 350 GAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV 351 - 420 FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNL 421 - 490 LLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV 491 - 557 //
PMID | Year | Title |
---|---|---|
26787880 | 2016 | S1PR1-mediated IFNAR1 degradation modulates plasmacytoid dendritic cell interferon-? autoamplification. |
26679999 | 2016 | Type I Interferon Signaling Is Decoupled from Specific Receptor Orientation through Lenient Requirements of the Transmembrane Domain. |
26679744 | 2015 | A functional polymorphism in IFNAR1 gene is associated with susceptibility and severity of HFMD with EV71 infection. |
26676772 | 2015 | Hemagglutinin of Influenza A Virus Antagonizes Type I Interferon (IFN) Responses by Inducing Degradation of Type I IFN Receptor 1. |
26159719 | 2015 | Flavivirus Antagonism of Type I Interferon Signaling Reveals Prolidase as a Regulator of IFNAR1 Surface Expression. |
26008745 | 2015 | Receptor dimerization dynamics as a regulatory valve for plasticity of type I interferon signaling. |
25939635 | 2015 | The interferon receptor-1 promoter polymorphisms affect the outcome of Caucasians with HBeAg-negative chronic HBV infection. |
25675103 | 2015 | IFNL4 and IFNL3 associated polymorphisms strongly influence the spontaneous IFN-alpha receptor-1 expression in HCV-infected patients. |
25501140 | 2014 | Association of the IFNAR1-17470 and IL-10-592 cytokine variants with susceptibility to chronic hepatitis B viral infections in a Chinese population. |
25445652 | 2015 | Interferon-? (IFNG) microsatellite repeat and single nucleotide polymorphism haplotypes of IFN-? receptor (IFNAR1) associated with enhanced malaria susceptibility in Indian populations. |
More... |