Property Summary

Ligand Count 5
NCBI Gene PubMed Count 138
PubMed Score 449.26
PubTator Score 192.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
hepatocellular carcinoma 1.100 1.1e-04
medulloblastoma, large-cell -1.200 1.3e-03
osteosarcoma -1.405 1.8e-04
ovarian cancer -2.000 3.9e-14
pancreatic cancer 1.500 1.6e-03
pancreatic carcinoma 1.500 1.6e-03
pancreatic ductal adenocarcinoma liver m... -1.999 7.9e-04
psoriasis 1.100 5.6e-04
tuberculosis and treatment for 6 months -1.300 1.6e-03

Protein-protein Interaction (1)

Gene RIF (120)

AA Sequence

MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGM      1 - 70
DNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDK     71 - 140
AIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRHKIYKLSPETTYCLKVKAALLTSW    141 - 210
KIGVYSPVHCIKTTVENELPPPENIEVSVQNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQI    211 - 280
PDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYI    281 - 350
GAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV    351 - 420
FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNL    421 - 490
LLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV       491 - 557
//

Text Mined References (147)

PMID Year Title