Property Summary

NCBI Gene PubMed Count 131
Grant Count 159
R01 Count 108
Funding $13,641,679.11
PubMed Score 407.39
PubTator Score 192.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.000
pancreatic cancer 1.500 0.002
psoriasis 1.100 0.001
osteosarcoma -1.405 0.000
medulloblastoma, large-cell -1.800 0.000
pancreatic ductal adenocarcinoma liver m... -1.999 0.001
tuberculosis and treatment for 6 months -1.500 0.007
pancreatic carcinoma 1.500 0.002
ovarian cancer -2.000 0.000

Synonym

Accession P17181 B2R6L9 B4DNT3 D3DSF0 Q53GW9 Q53H11 Q6PKD7 Q7M4L2 Q8WTZ2 IFN-R-1
Symbols AVP
IFRC
IFNAR
IFNBR
IFN-alpha-REC

Gene

PDB

4PO6   3SE3   3SE4   3S98  

Gene RIF (113)

PMID Text
26787880 data illustrate a lipid G-protein coupled receptor (GPCR)-IFNAR1 regulatory loop that balances effective and detrimental immune responses and elevated endogenous S1PR1 signaling
26679999 Data suggest IFNA2 (interferon, alpha 2) binding to extracellular domain of IFNAR1 or IFNAR2 promotes proximity between intracellular domains; signaling depends on duration of activation/affinity of binding rather than specific conformational changes.
26679744 rs2843710 of IFNAR1 was associated with the susceptibility and severity of EV71 HFMD in Chinese Han populations.
26676772 These findings suggest that influenza A virus hemagglutinin causes IFNAR1 degradation, which in turn helps the virus escape the powerful innate immune system.
26159719 Prolidase was required for IFNAR1 maturation and accumulation, activation of IFNbeta-stimulated gene induction, and IFN-I-dependent viral control.
26008745 Dimerization of IFNAR1 and IFNAR2 and the limiting role of IFNAR1 binding affinity in complex assembly is modulated by USP18.
25939635 Genetic polymorphisms of the promoter of INFAR gene represent important factors associated with the clinical phase of HBeAg-negative chronic HBV infection.
25675103 IFNL4 and IFNL3 associated polymorphisms strongly influence the spontaneous IFN-alpha receptor-1 expression in HCV-infected patients
25501140 sequence variants of both the IFNAR1-17470 and IL-10-592 genes were correlated with susceptibility to chronic hepatitis B.
25445652 Results show that SNPs in IFNAR1 and IFNG were risk factors for malaria in Indian population.
More...

AA Sequence

MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGM      1 - 70
DNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDK     71 - 140
AIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRHKIYKLSPETTYCLKVKAALLTSW    141 - 210
KIGVYSPVHCIKTTVENELPPPENIEVSVQNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQI    211 - 280
PDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYI    281 - 350
GAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV    351 - 420
FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNL    421 - 490
LLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV       491 - 557
//

Text Mined References (140)

PMID Year Title
26787880 2016 S1PR1-mediated IFNAR1 degradation modulates plasmacytoid dendritic cell interferon-? autoamplification.
26679999 2016 Type I Interferon Signaling Is Decoupled from Specific Receptor Orientation through Lenient Requirements of the Transmembrane Domain.
26679744 2015 A functional polymorphism in IFNAR1 gene is associated with susceptibility and severity of HFMD with EV71 infection.
26676772 2015 Hemagglutinin of Influenza A Virus Antagonizes Type I Interferon (IFN) Responses by Inducing Degradation of Type I IFN Receptor 1.
26159719 2015 Flavivirus Antagonism of Type I Interferon Signaling Reveals Prolidase as a Regulator of IFNAR1 Surface Expression.
26008745 2015 Receptor dimerization dynamics as a regulatory valve for plasticity of type I interferon signaling.
25939635 2015 The interferon receptor-1 promoter polymorphisms affect the outcome of Caucasians with HBeAg-negative chronic HBV infection.
25675103 2015 IFNL4 and IFNL3 associated polymorphisms strongly influence the spontaneous IFN-alpha receptor-1 expression in HCV-infected patients.
25501140 2014 Association of the IFNAR1-17470 and IL-10-592 cytokine variants with susceptibility to chronic hepatitis B viral infections in a Chinese population.
25445652 2015 Interferon-? (IFNG) microsatellite repeat and single nucleotide polymorphism haplotypes of IFN-? receptor (IFNAR1) associated with enhanced malaria susceptibility in Indian populations.
More...