Property Summary

NCBI Gene PubMed Count 54
Grant Count 10
R01 Count 6
Funding $260,258.01
PubMed Score 168.38
PubTator Score 87.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
26881519 Elevated aspartate aminotransferase level was associated with hepatocellular carcinoma.
26791191 Data suggest that, in context of abnormal hepatic lipid accumulation in nonalcoholic fatty liver disease, circulating GOT1 rises due to up-regulation of hepatic expression of GOT1 associated with greater gluconeogenesis and insulin resistance.
26290281 The serum hepcidin, ferritin, alanine transaminase, aspartate transaminase, gamma-glutamyltransferase and bilirubin were examined in two independent Chinese cohorts consisted of 3455 individuals.
26003525 Human GOT1 was expressed in E coli, purified by affinity chromatography and preliminary crystallographic studies were done.
25595905 We propose the GOT1 expression status as a simple and reliable prognostic biomarker in pancreatic ductal adenocarcinoma
25272068 The aim of this study was to establish the reference intervals (RIs) of total bilirubin (TBIL), alanine aminotransferase (ALT), aspartate transaminase (AST), and creatinine (CREA) for apparently healthy elderly (Han ethnicity) in Shuyang, China.
24849491 Significantly higher GOT levels were found in the 1-20 year age group of type 1
23667618 Alcohol consumption, smoking status, and metabolic syndrome impact on serum levels of aspartate aminotransferase (AST), alanine aminotransferase (ALT), and gamma-glutamyl transferase (GGT), was determined.
22352690 APRI and AST/ALT are independent predictors for significant fibrosis in chronic hepatitis C patients.
22242166 This study highlights the necessity of intensive follow-up for those with elevated AST and ALT levels and comorbid alcohol use disorder for preventing excessive natural deaths.
More...

AA Sequence

MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHE      1 - 70
YLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPT     71 - 140
WENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIA    141 - 210
SVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPES    211 - 280
ILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGT    281 - 350
WNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ           351 - 413
//

Text Mined References (61)

PMID Year Title
26881519 Cyclooxygenase-2 expression is associated with elevated aspartate aminotransferase level in hepatocellular carcinoma.
26791191 2016 Serum aminotransferases in nonalcoholic fatty liver disease are a signature of liver metabolic perturbations at the amino acid and Krebs cycle level.
26290281 2015 Elevated serum transaminase activities were associated with increased serum levels of iron regulatory hormone hepcidin and hyperferritinemia risk.
26003525 2015 Expression, purification and preliminary crystallographic studies of human glutamate oxaloacetate transaminase 1 (GOT1).
25595905 2015 GOT1/AST1 expression status as a prognostic biomarker in pancreatic ductal adenocarcinoma.
25272068 2014 Reference intervals for total bilirubin, ALT, AST and creatinine in healthy Chinese elderly.
24849491 2014 A comparative study of glutamate oxaloacetate transaminase (GOT) and glutamate pyruvate transaminase (GPT) levels in the saliva of diabetic and normal patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
23667618 2013 Independent and supra-additive effects of alcohol consumption, cigarette smoking, and metabolic syndrome on the elevation of serum liver enzyme levels.
More...