Property Summary

NCBI Gene PubMed Count 59
PubMed Score 173.09
PubTator Score 87.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.180 5.7e-04
adult high grade glioma -2.300 1.3e-06
astrocytic glioma -2.200 1.9e-03
Astrocytoma, Pilocytic -1.900 1.6e-09
atypical teratoid / rhabdoid tumor -2.200 1.2e-08
ependymoma -2.200 5.2e-03
gastric carcinoma -1.300 1.7e-02
glioblastoma -2.200 4.7e-12
group 3 medulloblastoma -2.100 9.5e-05
malignant mesothelioma 1.200 1.9e-06
medulloblastoma, large-cell -2.100 2.2e-05
non primary Sjogren syndrome sicca 1.200 3.2e-02
non-small cell lung cancer 1.018 2.0e-13
oligodendroglioma -1.700 5.2e-18
pancreatic ductal adenocarcinoma liver m... -1.691 1.6e-02
Pick disease -1.600 6.8e-04
primitive neuroectodermal tumor -2.000 4.4e-06
subependymal giant cell astrocytoma -1.997 1.8e-02
tuberculosis and treatment for 3 months -1.200 4.3e-07

Gene RIF (32)

AA Sequence

MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHE      1 - 70
YLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPT     71 - 140
WENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIA    141 - 210
SVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPES    211 - 280
ILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGT    281 - 350
WNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ           351 - 413
//

Text Mined References (66)

PMID Year Title