Property Summary

NCBI Gene PubMed Count 9
PubMed Score 252.48
PubTator Score 276.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (3)

AA Sequence

MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDE      1 - 70
TARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDA     71 - 140
YKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV                      141 - 192
//

Text Mined References (16)

PMID Year Title