Property Summary

NCBI Gene PubMed Count 9
PubMed Score 252.48
PubTator Score 276.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession P17152 Q53YB2
Symbols PM1
PMI
C17orf35

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDE      1 - 70
TARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDA     71 - 140
YKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV                      141 - 192
//

Text Mined References (16)

PMID Year Title