Property Summary

NCBI Gene PubMed Count 193
Grant Count 87
R01 Count 53
Funding $10,033,955.25
PubMed Score 418.26
PubTator Score 419.76

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P17096 P10910 Q5T6U9 Q9UKB0 HMG-I(Y)
Symbols HMG-R
HMGIY
HMGA1A

Gene

PDB

2EZD   2EZE   2EZF   2EZG  

Gene RIF (137)

PMID Text
27008379 This is the first report for the association between HMGA1 and S100A13 expression in the modulation of thyroid cancer growth and invasion.
26708416 in splenic hemangioma with t(3;6)(q26;p21), the entire coding region of HMGA1 comes under the control of the TBL1XR1 promoter, bringing about dysregulation of HMGA1
26527623 Data indicate that the high mobility group A1 (HMGA1) proteomic signature has prognostic value in breast cancer.
26296198 The HMGA1 rs146052672 genotype variant had an overall statistically significant effect on increasing the risk of development of type 2 diabetes mellitus in Europeans. (Meta-analysis)
26265440 In breast cancer patients, high levels of HMGA1 and CCNE2 expression are associated with the YAP/TAZ signature.
26251519 HMGA1 is overexpressed in human breast carcinomas and its levels are associated with a particular endocrine status.
26009886 Results show that HMGA1 binds CRMP1 promoter and regulates its expression in medulloblastoma cells.
25772486 HMGA1 plays an important role on breast cancer aggressiveness and prognosis and may act as a promising target for prognostic prediction.
25755724 The results of the present study indicate that miR-26a may be associated with human breast carcinogenesis, which inhibits tumor cell proliferation by targeting HMGA1.
25595895 CBX7/HMGA1b/NF-kappaB could take part in the same transcriptional mechanism that finally leads to the regulation of SPP1 gene expression in papillary thyroid carcinoma.
More...

AA Sequence

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAA      1 - 70
KTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ                                      71 - 107
//

Text Mined References (209)

PMID Year Title
27008379 2016 The association between S100A13 and HMGA1 in the modulation of thyroid cancer proliferation and invasion.
26708416 2016 Fusion of the TBL1XR1 and HMGA1 genes in splenic hemangioma with t(3;6)(q26;p21).
26527623 2016 Translating Proteomic Into Functional Data: An High Mobility Group A1 (HMGA1) Proteomic Signature Has Prognostic Value in Breast Cancer.
26296198 2015 The Association between HMGA1 rs146052672 Variant and Type 2 Diabetes: A Transethnic Meta-Analysis.
26265440 2015 A novel HMGA1-CCNE2-YAP axis regulates breast cancer aggressiveness.
26251519 2016 HMGA1 overexpression is associated with a particular subset of human breast carcinomas.
26009886 2015 CRMP1 Inhibits Proliferation of Medulloblastoma and Is Regulated by HMGA1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772486 2015 Overexpression of HMGA1 correlates with the malignant status and prognosis of breast cancer.
25755724 2015 MicroRNA-26a inhibits proliferation by targeting high mobility group AT-hook 1 in breast cancer.
More...