Property Summary

NCBI Gene PubMed Count 208
PubMed Score 433.83
PubTator Score 419.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
colon cancer 1.400 3.0e-02
ductal carcinoma in situ 1.300 1.7e-03
glioblastoma 1.700 5.8e-05
intraductal papillary-mucinous carcinoma... 1.200 4.6e-04
invasive ductal carcinoma 1.800 2.8e-03
lung cancer 2.100 2.9e-04
medulloblastoma, large-cell 2.100 1.8e-03
non-small cell lung cancer 1.950 3.0e-21
osteosarcoma -2.615 7.6e-05
ovarian cancer 1.900 4.6e-07
pancreatic cancer 1.200 1.1e-04
pancreatic ductal adenocarcinoma liver m... 2.284 1.3e-03
pediatric high grade glioma 1.300 9.2e-05
posterior fossa group B ependymoma -1.300 5.6e-08

Protein-protein Interaction (12)

Gene RIF (150)

AA Sequence

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAA      1 - 70
KTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ                                      71 - 107
//

Text Mined References (226)

PMID Year Title