Property Summary

NCBI Gene PubMed Count 29
PubMed Score 28.27
PubTator Score 39.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 2.277 7.1e-03
active ulcerative colitis 1.960 1.6e-02
acute quadriplegic myopathy -1.001 4.1e-04
ductal carcinoma in situ -1.300 2.3e-03
ependymoma 1.200 7.5e-05
group 4 medulloblastoma -1.100 1.8e-03
hereditary spastic paraplegia -1.128 1.6e-02
intraductal papillary-mucinous carcinoma... -1.400 7.6e-03
intraductal papillary-mucinous neoplasm ... -1.400 4.8e-02
invasive ductal carcinoma -1.600 2.3e-03
ovarian cancer -1.300 2.6e-08
Pick disease 1.200 1.8e-04
psoriasis -1.200 5.9e-06
subependymal giant cell astrocytoma 2.636 2.8e-03

Gene RIF (11)

AA Sequence

MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDY      1 - 70
DRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKE     71 - 140
KPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT         141 - 205
//

Text Mined References (29)

PMID Year Title