Property Summary

NCBI Gene PubMed Count 29
Grant Count 4
Funding $40,719.37
PubMed Score 25.99
PubTator Score 39.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P17081 D6W5A6 Q0VGN1 Q52LS8 Q53SJ1 Q6NS39 Q6P146 Q7Z480
Symbols ARHQ
TC10
TC10A
RASL7A
HEL-S-42

Gene

PDB

2ATX  

Gene RIF (11)

PMID Text
24663214 Novel tumor-associated increase of RNA editing in ras homologue family member Q (RHOQ) transcripts, is reported.
24297911 The enhancement of Cb-induced gephyrin clustering by GTP-TC10 does not depend on the guanine nucleotide exchange activity of Cb but involves an interaction that resembles reported interactions of other small GTPases with their effectors
24223996 Exocytosis of Rab11- and L1-positive vesicles may play a central role in TC10-mediated neurite outgrowth
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19258391 These findings reveal a novel signaling pathway in human skeletal muscle that involves obscurin and the Rho GTPase TC10 and implicate this pathway in new sarcomere formation.
18660489 Observational study of gene-disease association. (HuGE Navigator)
16950130 We propose that an EGF-stimulated GAP accelerates GTP hydrolysis of TC10, thereby promoting vesicle fusion.
16246732 The crystal structure of TC10 proved that the basic region of WASp and two unique glutamates in Cdc42 generate favorable electrostatic steering forces that control the accelerated WASp-Cdc42 association reaction.
15546864 The GTP-bound form of TC10 directs the trafficking of CFTR from the juxtanuclear region to the secretory pathway toward the plasma membrane
12972548 Overexpression of the Rho family member TC10alpha, disrupts adipocyte cortical actin structure and inhibits insulin-stimulated GLUT4 translocation
More...

AA Sequence

MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDY      1 - 70
DRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKE     71 - 140
KPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT         141 - 205
//

Text Mined References (29)

PMID Year Title
24663214 2014 RNA editing in RHOQ promotes invasion potential in colorectal cancer.
24297911 2013 Collybistin activation by GTP-TC10 enhances postsynaptic gephyrin clustering and hippocampal GABAergic neurotransmission.
24223996 2013 GTP hydrolysis of TC10 promotes neurite outgrowth through exocytic fusion of Rab11- and L1-containing vesicles by releasing exocyst component Exo70.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
19258391 2009 TC10 controls human myofibril organization and is activated by the sarcomeric RhoGEF obscurin.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
16950130 2006 GTP hydrolysis by the Rho family GTPase TC10 promotes exocytic vesicle fusion.
16246732 2005 An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins.
15546864 2005 Regulation of cystic fibrosis transmembrane regulator trafficking and protein expression by a Rho family small GTPase TC10.
More...