Property Summary

NCBI Gene PubMed Count 47
Grant Count 10
R01 Count 9
Funding $875,413.34
PubMed Score 84.23
PubTator Score 10.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 3.200 0.000

Gene RIF (36)

PMID Text
26656590 endothelial nitric oxide synthase induces heat shock protein HSPA6 (HSP70B') in human arterial smooth muscle cells
25957766 Data indicate that heat shock protein 90kD(HSP90) inhibition induces heat shock 70kD protein 6 (HSP70B') expression.
25798051 High BCLC staging scores, advanced cirrhosis and the overexpression of HSPA12A and HSP90B1 might be associated with poor survival from HCC, whereas high levels of HSPA4, HSPA5 and HSPA6 might be associated with earlier recurrence of HCC
25447897 HSPA6 regulation by TNIP1 occurs in promoter regions lacking binding sites for known TNIP1-repressed transcription factors
25319762 Potential stress-sensitive sites were identified in differentiated human SH-SY5Y cells by the localization of HSPA6 (HSP70B') and HSPA1A (HSP70-1) to nuclear components following heat shock
24742347 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
24061851 Following a brief period of thermal stress, YFP-tagged HSPA6 and HSPA1A rapidly appeared at centrioles in the cytoplasm of human neuronal cells.
22190034 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
21763498 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
21763498 HIV-1 and the viral protein Tat modulate the expression of heat shock 70kDa protein 6 (HSPA6; HSP70B') in immature dendritic cells and monocyte-derived macrophages
More...

AA Sequence

MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQAALNPHNTVF      1 - 70
DAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEEISSMVLSKMKETAEAYLGQP     71 - 140
VKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDRRGAGERNVLIFDLGGGTFDVS    141 - 210
VLSIDAGVFEVKATAGDTHLGGEDFDNRLVNHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSST    211 - 280
QATLEIDSLFEGVDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQK    281 - 350
LLQDFFNGKELNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA    351 - 420
TIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSV    421 - 490
TATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESL    491 - 560
RDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQ    561 - 630
GDPSTGPIIEEVD                                                             631 - 643
//

Text Mined References (49)

PMID Year Title
26656590 2016 Endothelial nitric oxide synthase induces heat shock protein HSPA6 (HSP70B') in human arterial smooth muscle cells.
26001115 2015 The Broad-Spectrum Antiviral Protein ZAP Restricts Human Retrotransposition.
25957766 2015 Induction of heat shock protein HSPA6 (HSP70B') upon HSP90 inhibition in cancer cell lines.
25798051 2015 Upregulation of heat shock proteins (HSPA12A, HSP90B1, HSPA4, HSPA5 and HSPA6) in tumour tissues is associated with poor outcomes from HBV-related early-stage hepatocellular carcinoma.
25447897 2015 TNIP1 reduction of HSPA6 gene expression occurs in promoter regions lacking binding sites for known TNIP1-repressed transcription factors.
25319762 2014 Localization of heat shock protein HSPA6 (HSP70B') to sites of transcription in cultured differentiated human neuronal cells following thermal stress.
24061851 2014 Stress-induced localization of HSPA6 (HSP70B') and HSPA1A (HSP70-1) proteins to centrioles in human neuronal cells.
24039173 2013 Genetic predictors of risk and resilience in psychiatric disorders: a cross-disorder genome-wide association study of functional impairment in major depressive disorder, bipolar disorder, and schizophrenia.
23921388 2013 Identification and characterization of a novel human methyltransferase modulating Hsp70 protein function through lysine methylation.
23652523 2013 Identification of genetic loci associated with Helicobacter pylori serologic status.
More...