Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.22
PubTator Score 6.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 2.400 3.6e-02
group 3 medulloblastoma 2.100 1.3e-04
intraductal papillary-mucinous carcinoma... 1.500 3.1e-03
lung cancer 1.400 2.7e-03
oligodendroglioma 1.100 1.3e-13
osteosarcoma -2.186 9.3e-08
ovarian cancer -1.400 1.3e-04
posterior fossa group B ependymoma 1.300 1.6e-05
primitive neuroectodermal tumor 1.400 6.4e-03

Gene RIF (1)

AA Sequence

METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEP      1 - 70
AQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPL     71 - 140
GNSPGERLNRKMPDFGQVTVEEKLTPRGERSEKYNDFGNSFTVNSNLISHQRLPVGDRPHKCDECSKSFN    141 - 210
RTSDLIQHQRIHTGEKPYECNECGKAFSQSSHLIQHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTG    211 - 280
EKPYECNECGKTFSWSSTLTHHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFS    281 - 350
QSSHLYQHQRIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTG    351 - 420
EKPLNGIGMSKSSLRVTTELNIREST                                                421 - 446
//

Text Mined References (18)

PMID Year Title