Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.30
PubTator Score 6.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
oligodendroglioma 2849 1.33475391418935E-13
osteosarcoma 7933 7.54333997151755E-11
posterior fossa group B ependymoma 1530 1.63178310161493E-5
group 3 medulloblastoma 2254 1.30138775589704E-4
ovarian cancer 8492 1.31465710728622E-4
lung cancer 4473 0.00265650356267512
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00308847963110614
primitive neuroectodermal tumor 3031 0.00636590066993655
Breast cancer 3099 0.0355700541190263

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma 1.100 0.000
osteosarcoma -3.154 0.000
group 3 medulloblastoma 2.100 0.000
primitive neuroectodermal tumor 1.400 0.006
intraductal papillary-mucinous carcinoma... 1.500 0.003
lung cancer 1.400 0.003
Breast cancer 2.400 0.036
posterior fossa group B ependymoma 1.300 0.000
ovarian cancer -1.400 0.000

Synonym

Accession P17036 D6W5U0 P13683 Q9HBR4 Q9NNX8 Q9NXJ1 Q9UC15 Q9UC16
Symbols A8-51
HF.12
KOX25
PP838
Zfp113

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
21555518 ZNF3 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.

AA Sequence

METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEP      1 - 70
AQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPL     71 - 140
GNSPGERLNRKMPDFGQVTVEEKLTPRGERSEKYNDFGNSFTVNSNLISHQRLPVGDRPHKCDECSKSFN    141 - 210
RTSDLIQHQRIHTGEKPYECNECGKAFSQSSHLIQHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTG    211 - 280
EKPYECNECGKTFSWSSTLTHHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFS    281 - 350
QSSHLYQHQRIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTG    351 - 420
EKPLNGIGMSKSSLRVTTELNIREST                                                421 - 446
//

Text Mined References (17)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18255255 2008 A protein-protein interaction network of transcription factors acting during liver cell proliferation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...