Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.30
PubTator Score 6.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma 1.100 0.000
osteosarcoma -3.154 0.000
group 3 medulloblastoma 2.100 0.000
primitive neuroectodermal tumor 1.400 0.006
intraductal papillary-mucinous carcinoma... 1.500 0.003
lung cancer 1.400 0.003
Breast cancer 2.400 0.036
posterior fossa group B ependymoma 1.300 0.000
ovarian cancer -1.400 0.000

Gene RIF (1)

PMID Text
21555518 ZNF3 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.

AA Sequence

METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEP      1 - 70
AQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPL     71 - 140
GNSPGERLNRKMPDFGQVTVEEKLTPRGERSEKYNDFGNSFTVNSNLISHQRLPVGDRPHKCDECSKSFN    141 - 210
RTSDLIQHQRIHTGEKPYECNECGKAFSQSSHLIQHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTG    211 - 280
EKPYECNECGKTFSWSSTLTHHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFS    281 - 350
QSSHLYQHQRIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTG    351 - 420
EKPLNGIGMSKSSLRVTTELNIREST                                                421 - 446
//

Text Mined References (17)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18255255 2008 A protein-protein interaction network of transcription factors acting during liver cell proliferation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...