Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.24
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.6e-15
malignant mesothelioma 3232 5.1e-07
osteosarcoma 7950 3.1e-04
lung cancer 4740 3.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.400 3.5e-04
malignant mesothelioma 1.900 5.1e-07
osteosarcoma -1.240 3.1e-04
psoriasis -1.100 5.6e-15

Gene RIF (1)

AA Sequence

MATSFRTASCWGLLSFKDISMEFTWDEWQLLDSTQKYLYRDVILENYHNLISVGYHGTKPDLIFKLEQGE      1 - 70
DPWIINAKISRQSCPDGWEEWYQNNQDELESIERSYACSVLGRLNLSKTHDSSRQRLYNTRGKSLTQNSA     71 - 140
PSRSYLRKNPDKFHGYEEPYFLKHQRAHSIEKNCVCSECGKAFRCKSQLIVHLRIHTGERPYECSKCERA    141 - 210
FSAKSNLNAHQRVHTGEKPYSCSECEKVFSFRSQLIVHQEIHTGGKPYGCSECGKAYSWKSQLLLHQRSH    211 - 280
TGVKPYECSECGKAFSLKSPFVVHQRTHTGVKPHKCSECGKAFRSKSYLLVHIRMHTGEKPYQCSDCGKA    281 - 350
FNMKTQLIVHQGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTH    351 - 420
TGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKA    421 - 490
FTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK                               491 - 533
//

Text Mined References (11)

PMID Year Title