Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.48
PubTator Score 5.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.300 1.3e-02
breast carcinoma 1.500 1.4e-02
ependymoma 1.100 1.6e-02
group 3 medulloblastoma 1.300 1.1e-04
intraductal papillary-mucinous adenoma (... 1.100 1.9e-02
intraductal papillary-mucinous carcinoma... 1.200 2.5e-03
juvenile dermatomyositis 1.023 1.7e-11
lung carcinoma 1.500 9.8e-25
oligodendroglioma 1.500 5.2e-03
osteosarcoma 1.342 1.6e-04
ovarian cancer -1.800 1.1e-07
tuberculosis and treatment for 6 months -1.400 5.0e-04

Gene RIF (6)

AA Sequence

MMTAESREATGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSTLQDTPPPDPEIFRQRFRRFCYQNTFGP      1 - 70
REALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLSG     71 - 140
QQVPGQVHGPEMLARGMVPLDPVQESSSFDLHHEATQSHFKHSSRKPRLLQSRALPAAHIPAPPHEGSPR    141 - 210
DQAMASALFTADSQAMVKIEDMAVSLILEEWGCQNLARRNLSRDNRQENYGSAFPQGGENRNENEESTSK    211 - 280
AETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREK    281 - 350
GKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL    351 - 420
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRIHTGEKPYE    421 - 490
CSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHARERASEYSPASLDAFGAFLK    491 - 560
SCV                                                                       561 - 563
//

Text Mined References (33)

PMID Year Title