Property Summary

NCBI Gene PubMed Count 21
PubMed Score 11.38
PubTator Score 5.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 9.79668728870844E-25
juvenile dermatomyositis 1189 1.69308310196548E-11
osteosarcoma 7933 9.48371551633979E-8
group 3 medulloblastoma 2254 1.08573446157364E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.54805316507026E-4
ovarian cancer 8492 4.9951186807453E-4
tuberculosis and treatment for 6 months 686 5.02968501950682E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00248959831378823
oligodendroglioma 2849 0.00524720382950928
astrocytic glioma 2241 0.0126183999735421
breast carcinoma 1614 0.0143908302585027
ependymoma 2514 0.0160736136906379

Expression

  Differential Expression (12)

Synonym

Accession P17029 A4D294 P52745 Q2M1U1 Q8TBW5 Q8TEK7
Symbols KOX18
ZNF36
PHZ-37
ZNF139
ZSCAN33

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Anole lizard OMA EggNOG

Gene RIF (5)

PMID Text
26722429 ZNF139 functions to promote apoptosis resistance of gastric cancer cells by regulating some apoptosis related genes.
25561801 ZNF139 expression is related to clinicopathologic characteristics and prognosis of gastric cancer. It is overexpressed and involved in apoptosis in GC tissues by regulating caspase-3.
25436386 ZNF139 gene may influence the biological behavior of gastric cancer cells in many ways by regulating multiple proteins.
24824930 Knocking down ZNF139 expression in gastric cancer cells could effectively reduce gastric cancer cell invasion and migration ability
24515389 ZNF139 was involved in GC MDR by promoting expressions of MDR1/P-gp, MRP1 and Bcl-2 and inhibiting Bax simultaneously.

AA Sequence

MMTAESREATGLSPQAAQEKDGIVIVKVEEEDEEDHMWGQDSTLQDTPPPDPEIFRQRFRRFCYQNTFGP      1 - 70
REALSRLKELCHQWLRPEINTKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLSG     71 - 140
QQVPGQVHGPEMLARGMVPLDPVQESSSFDLHHEATQSHFKHSSRKPRLLQSRALPAAHIPAPPHEGSPR    141 - 210
DQAMASALFTADSQAMVKIEDMAVSLILEEWGCQNLARRNLSRDNRQENYGSAFPQGGENRNENEESTSK    211 - 280
AETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREK    281 - 350
GKGLGRSFSLSSNFTTPEEVPTGTKSHRCDECGKCFTRSSSLIRHKIIHTGEKPYECSECGKAFSLNSNL    351 - 420
VLHQRIHTGEKPHECNECGKAFSHSSNLILHQRIHSGEKPYECNECGKAFSQSSDLTKHQRIHTGEKPYE    421 - 490
CSECGKAFNRNSYLILHRRIHTREKPYKCTKCGKAFTRSSTLTLHHRIHARERASEYSPASLDAFGAFLK    491 - 560
SCV                                                                       561 - 563
//

Text Mined References (31)

PMID Year Title
27698826 2016 Effects of ZNF139 on gastric cancer cells and mice with gastric tumors.
26722429 2015 Silencing of ZNF139-siRNA induces apoptosis in human gastric cancer cell line BGC823.
26013381 2015 Activating MET kinase rearrangements in melanoma and Spitz tumours.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25561801 2014 Zinc finger protein 139 expression in gastric cancer and its clinical significance.
25436386 2014 Comparative proteomics in gastric cancer cell line BGC823 after ZNF139 gene inhibited with RNA interference.
25416956 2014 A proteome-scale map of the human interactome network.
25281217 2014 Short intronic repeat sequences facilitate circular RNA production.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24824930 2014 ZNF139 promotes tumor metastasis by increasing migration and invasion in human gastric cancer cells.
More...