Property Summary

NCBI Gene PubMed Count 28
PubMed Score 33.74
PubTator Score 22.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 6.2e-07
dermatomyositis 1.400 4.5e-04
ependymoma 1.100 7.1e-07
glioblastoma 1.300 1.0e-04
group 4 medulloblastoma 1.600 3.6e-05
medulloblastoma, large-cell 1.800 2.4e-04
oligodendroglioma 1.100 5.3e-03
osteosarcoma 2.694 9.2e-07
ovarian cancer -1.200 5.4e-04
psoriasis -1.800 2.5e-04
Rheumatoid arthritis 1.200 1.3e-02
spina bifida -1.384 4.1e-02

Gene RIF (11)

AA Sequence

MSAQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFRQRFRQFGYQDSPGPREAV      1 - 70
SQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVRDHHPENGEEAVTVLEDLESELDDPGQP     71 - 140
VSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSAL    141 - 210
ESHEVPGTLNMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYG    211 - 280
CVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNL    281 - 350
FRHQRRHNAEKLLNVVKV                                                        351 - 368
//

Text Mined References (39)

PMID Year Title