Property Summary

NCBI Gene PubMed Count 25
Grant Count 5
R01 Count 5
Funding $1,670,658
PubMed Score 32.57
PubTator Score 22.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.013
oligodendroglioma 1.100 0.005
psoriasis -1.800 0.000
osteosarcoma 2.782 0.000
posterior fossa group B ependymoma 1.200 0.000
group 4 medulloblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.800 0.000
spina bifida -1.384 0.041
ovarian cancer 1.400 0.000
dermatomyositis 1.400 0.000

Synonym

Accession P17028 O14754 Q53YE4 Q6ICR5 Q8IZN4
Symbols KOX17
RSG-A
ZNF191
ZSCAN3
Zfp191

Gene

PANTHER Protein Class (1)

PDB

1X6E   3LHR  

Gene RIF (11)

PMID Text
26317898 miR-940 promoted gastric cancer progression by directly downregulating ZNF24 expression.
25550468 In vivo, knockdown of ZNF24 specifically in microvascular endothelial cells led to significantly decreased formation of functional vascular networks.
24224020 results suggest that consecutive ZF1-2 is critical for the regulation of ZNF24 nuclear localization and its transactivation function.
23212515 ZNF24 represses VEGF transcription through direct binding to an 11-bp fragment of the VEGF proximal promoter and that it functions as a negative regulator of tumor growth by inhibiting angiogenesis.
22678762 ZNF24 may be implicated in transcriptional regulation of genes associated with oncogenesis via interaction with H2A.Z.
22213192 ZNF191 can directly bind to the CTNNB1 promoter and activate the expression of beta-catenin and its downstream target genes such as cyclin D1 in hepatoma cell lines.
20510677 These data suggest that ZNF24 is involved in negative regulation of PDGFR-beta and may represent a novel repressor of PDGFR-beta transcription.
20453000 Observational study of gene-disease association. (HuGE Navigator)
19544452 Data confirm ZNF191 as an essential factor acting for the promotion of the cell cycle and thus maintenance in the progenitor stage.
19463170 ZNF191 is a pleiotropic factor that has a role in hematopoiesis, brain development, and tumor growth.
More...

AA Sequence

MSAQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFRQRFRQFGYQDSPGPREAV      1 - 70
SQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVRDHHPENGEEAVTVLEDLESELDDPGQP     71 - 140
VSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSAL    141 - 210
ESHEVPGTLNMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYG    211 - 280
CVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNL    281 - 350
FRHQRRHNAEKLLNVVKV                                                        351 - 368
//

Text Mined References (35)

PMID Year Title
26317898 2015 MicroRNA-940 promotes tumor cell invasion and metastasis by downregulating ZNF24 in gastric cancer.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25550468 2015 The endogenous zinc finger transcription factor, ZNF24, modulates the angiogenic potential of human microvascular endothelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24224020 2013 Identification of a functional nuclear localization signal mediating nuclear import of the zinc finger transcription factor ZNF24.
23212515 2013 Transcriptional repression of VEGF by ZNF24: mechanistic studies and vascular consequences in vivo.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...