Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.19
PubTator Score 6.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Liver carcinoma 217

Expression

Gene RIF (4)

PMID Text
21965783 ZNF23 gene could play an important role in the development of hepatocellular carcinoma.
18384939 ZNF23 induced apoptosis partially via down-regulation of Bcl-XL.
17137575 ZNF23 is a new member of KRAB-ZNF superfamily with growth-inhibitory ability and its downregulation may contribute to carcinogenesis
12127974 Characterization of ZNF359 and its role in human development

AA Sequence

MLENYGNVASLGFPLLKPAVISQLEGGSELGGSSPLAAGTGLQGLQTDIQTDNDLTKEMYEGKENVSFEL      1 - 70
QRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQPS     71 - 140
GCTGLGKSISFDTKLVKHEIINSEERPFKCEELVEPFRCDSQLIQHQENNTEEKPYQCSECGKAFSINEK    141 - 210
LIWHQRLHSGEKPFKCVECGKSFSYSSHYITHQTIHSGEKPYQCKMCGKAFSVNGSLSRHQRIHTGEKPY    211 - 280
QCKECGNGFSCSSAYITHQRVHTGEKPYECNDCGKAFNVNAKLIQHQRIHTGEKPYECNECGKGFRCSSQ    281 - 350
LRQHQSIHTGEKPYQCKECGKGFNNNTKLIQHQRIHTGEKPYECTECGKAFSVKGKLIQHQRIHTGEKPY    351 - 420
ECNECGKAFRCNSQFRQHLRIHTGEKPYECNECGKAFSVNGKLMRHQRIHTGEKPFECNECGRCFTSKRN    421 - 490
LLDHHRIHTGEKPYQCKECGKAFSINAKLTRHQRIHTGEKPFKCMECEKAFSCSSNYIVHQRIHTGEKPF    491 - 560
QCKECGKAFHVNAHLIRHQRSHTGEKPFRCVECGKGFSFSSDYIIHQTVHTWKKPYMCSVCGKAFRFSFQ    561 - 630
LSQHQSVHSEGKS                                                             631 - 643
//

Text Mined References (13)

PMID Year Title
21965783 2011 Expression of zinc finger 23 gene in human hepatocellular carcinoma.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18384939 2008 ZNF23 induces apoptosis in human ovarian cancer cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17137575 2007 Characterization of ZNF23, a KRAB-containing protein that is downregulated in human cancers and inhibits cell cycle progression.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12127974 2002 Identification and characterization of two novel zinc finger genes, ZNF359 and ZFP28, in human development.
More...