Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.14
PubTator Score 6.98

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P17026 Q5T741 Q96FM4
Symbols KOX15
HKR-T1
ZNF422
Zfp422

Gene

AA Sequence

MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKPYKCTECEKSFSQSSTL      1 - 70
FQHQKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGESFKQSSNLIQHQRIHTGEKPYQ     71 - 140
CDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGKNIRVKTHLPS    141 - 210
WKAGTGRKSVAGLR                                                            211 - 224
//

Text Mined References (15)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14630903 2003 The human KROX-26/ZNF22 gene is expressed at sites of tooth formation and maps to the locus for permanent tooth agenesis (He-Zhao deficiency).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
More...