Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.96
PubTator Score 4.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 5.3e-03
glioblastoma -1.200 9.2e-04
intraductal papillary-mucinous adenoma (... 1.400 6.0e-04
intraductal papillary-mucinous carcinoma... 1.300 3.2e-04
medulloblastoma, large-cell -1.100 2.3e-03
osteosarcoma -1.757 5.5e-05
ovarian cancer -1.300 1.4e-06
spina bifida 1.004 3.6e-02

Gene RIF (1)

AA Sequence

MTPASASGEDSGSFYSWQKAKREQGLVTFEDVAVDFTQEEWQYLNPPQRTLYRDVMLETYSNLVFVGQQV      1 - 70
TKPNLILKLEVEECPAEGKIPFWNFPEVCQVDEQIERQHQDDQDKCLLMQVGFSDKKTIITKSARDCHEF     71 - 140
GNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRSSAENKYDNGCAKLFFHTEYEKTNPGMKPYGYKE    141 - 210
CGKGLRRKKGLSLHQRIKNGEKPFECTACRKTFSKKSHLIVHWRTHTGEKPFGCTECGKAFSQKSQLIIH    211 - 280
LRTHTGERPFECPECGKAFREKSTVIIHYRTHTGEKPYECNECGKAFTQKSNLIVHQKTHTGEKTYECTK    281 - 350
CGESFIQKLDLIIHHSTHTGKKPHECNECKKTFSDKSTLIIHQRTHTGEKPHKCTECGKSFNEKSTLIVH    351 - 420
QRTHTGEKPYECDVCGKTFTQKSNLGVHQRTHSGEKPFECNECEKAFSQKSYLMLHQRGHTGEKPYECNE    421 - 490
CEKAFSQKSYLIIHQRTHTEEKPYKCNECGKAFREKSKLIIHQRIHTGEKPYECPVCWKAFSQKSQLIIH    491 - 560
QRTHTGEKPYACTECGKAFREKSTFTVHQRTHTGEKPYKCTECGKAFTQKSNLIVHQRTHAGKKAHGRGH    561 - 630
TRKSKFMAH                                                                 631 - 639
//

Text Mined References (10)

PMID Year Title