Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
Funding $9,028.5
PubMed Score 4.96
PubTator Score 4.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.757 0.000
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.100 0.002
intraductal papillary-mucinous adenoma (... 1.400 0.001
intraductal papillary-mucinous carcinoma... 1.300 0.000
adult high grade glioma -1.200 0.005
spina bifida 1.004 0.036
ovarian cancer -1.300 0.000

Gene RIF (1)

PMID Text
18187620 Knockdown of zinc finger protein 182 (ZNF182) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MTPASASGEDSGSFYSWQKAKREQGLVTFEDVAVDFTQEEWQYLNPPQRTLYRDVMLETYSNLVFVGQQV      1 - 70
TKPNLILKLEVEECPAEGKIPFWNFPEVCQVDEQIERQHQDDQDKCLLMQVGFSDKKTIITKSARDCHEF     71 - 140
GNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRSSAENKYDNGCAKLFFHTEYEKTNPGMKPYGYKE    141 - 210
CGKGLRRKKGLSLHQRIKNGEKPFECTACRKTFSKKSHLIVHWRTHTGEKPFGCTECGKAFSQKSQLIIH    211 - 280
LRTHTGERPFECPECGKAFREKSTVIIHYRTHTGEKPYECNECGKAFTQKSNLIVHQKTHTGEKTYECTK    281 - 350
CGESFIQKLDLIIHHSTHTGKKPHECNECKKTFSDKSTLIIHQRTHTGEKPHKCTECGKSFNEKSTLIVH    351 - 420
QRTHTGEKPYECDVCGKTFTQKSNLGVHQRTHSGEKPFECNECEKAFSQKSYLMLHQRGHTGEKPYECNE    421 - 490
CEKAFSQKSYLIIHQRTHTEEKPYKCNECGKAFREKSKLIIHQRIHTGEKPYECPVCWKAFSQKSQLIIH    491 - 560
QRTHTGEKPYACTECGKAFREKSTFTVHQRTHTGEKPYKCTECGKAFTQKSNLIVHQRTHAGKKAHGRGH    561 - 630
TRKSKFMAH                                                                 631 - 639
//

Text Mined References (9)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8914609 1996 Localization of a novel zinc finger gene to the human chromosome 7p11.2-p12 by fluorescence in situ hybridization.
8088786 1994 Clustered organization of Krüppel zinc-finger genes at Xp11.23, flanking a translocation breakpoint at OATL1: a physical map with locus assignments for ZNF21, ZNF41, ZNF81, and ELK1.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
2014798 1991 Twenty-seven nonoverlapping zinc finger cDNAs from human T cells map to nine different chromosomes with apparent clustering.