Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.41
PubTator Score 2.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.7e-05
osteosarcoma 7950 6.3e-05
acute myeloid leukemia 783 6.0e-03
lung cancer 4740 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia 2.100 6.0e-03
lung cancer 1.100 3.9e-02
osteosarcoma -1.435 6.3e-05
psoriasis -2.000 1.7e-05

AA Sequence

MDSVSFEDVAVNFTLEEWALLDSSQKKLYEDVMQETFKNLVCLGKKWEDQDIEDDHRNQGKNRRCHMVER      1 - 70
LCESRRGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFIHHSSLNRHMRSHTGQKPNEYQEYEKQP     71 - 140
CKCKAVGKTFSYHHCFRKHERTHTGVKPYECKQCGKAFIYYQPFQRHERTHAGQKPYECKQCGKTFIYYQ    141 - 210
SFQKHAHTGKKPYECKQCGKAFICYQSFQRHKRTHTGEKPYECKQCGKAFSCPTYFRTHERTHTGEKPYK    211 - 280
CKECGKAFSFLSSFRRHKRTHSGEKPYECKECGKAFFYSASFRAHVIIHTGARPYKCKECGKAFNSSNSC    281 - 350
RVHERTHIGEKPYECKRCGKSFSWSISLRLHERTHTGEKPYECKQCHKTFSFSSSLREHETTHTGEKPYE    351 - 420
CKQCGKTFSFSSSLQRHERTHNAEKPYECKQCGKAFRCSSYFRIHERSHTGEKPYECKQCGKVFIRSSSF    421 - 490
RLHERTHTGEKPYECKLCGKTFSFSSSLREHEKIHTGNKPFECKQCGKAFLRSSQIRLHERTHTGEKPYQ    491 - 560
CKQCGKAFISSSKFRMHERTHTGEKPYRCKQCGKAFRFSSSVRIHERSHTGEKPYECKQCGKAFISSSHF    561 - 630
RLHERTHMGEKV                                                              631 - 642
//

Text Mined References (8)

PMID Year Title