Property Summary

NCBI Gene PubMed Count 44
PubMed Score 134.45
PubTator Score 101.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 8.8e-05
Breast cancer 1.100 3.0e-10
ependymoma 1.100 1.1e-09
glioblastoma 1.200 2.4e-05
group 4 medulloblastoma 1.300 1.9e-04
malignant mesothelioma -1.200 1.0e-05
medulloblastoma, large-cell 1.500 7.3e-07
osteosarcoma 2.377 2.1e-04
ovarian cancer -1.200 5.7e-06
tuberculosis and treatment for 6 months 1.100 8.4e-03

Gene RIF (28)

AA Sequence

MDEDGLELQQEPNSFFDATGADGTHMDGDQIVVEVQETVFVSDVVDSDITVHNFVPDDPDSVVIQDVIED      1 - 70
VVIEDVQCPDIMEEADVSETVIIPEQVLDSDVTEEVSLAHCTVPDDVLASDITSASMSMPEHVLTGDSIH     71 - 140
VSDVGHVGHVGHVEHVVHDSVVEAEIVTDPLTTDVVSEEVLVADCASEAVIDANGIPVDQQDDDKGNCED    141 - 210
YLMISLDDAGKIEHDGSSGMTMDTESEIDPCKVDGTCPEVIKVYIFKADPGEDDLGGTVDIVESEPENDH    211 - 280
GVELLDQNSSIRVPREKMVYMTVNDSQPEDEDLNVAEIADEVYMEVIVGEEDAAAAAAAAAVHEQQMDDN    281 - 350
EIKTFMPIAWAAAYGNNSDGIENRNGTASALLHIDESAGLGRLAKQKPKKRRRPDSRQYQTAIIIGPDGH    351 - 420
PLTVYPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYRCTDCDYTTNKKISLHNHLESHKLTSKAEKAIEC    421 - 490
DECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSKNFPHICVECGKGFRHP    491 - 560
SELKKHMRIHTGEKPYQCQYCEYRSADSSNLKTHVKTKHSKEMPFKCDICLLTFSDTKEVQQHALIHQES    561 - 630
KTHQCLHCDHKSSNSSDLKRHIISVHTKDYPHKCDMCDKGFHRPSELKKHVAAHKGKKMHQCRHCDFKIA    631 - 700
DPFVLSRHILSVHTKDLPFRCKRCRKGFRQQSELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIH    701 - 770
TKDYPHRCEYCKKGFRRPSEKNQHIMRHHKEVGLP                                       771 - 805
//

Text Mined References (46)

PMID Year Title