Property Summary

NCBI Gene PubMed Count 36
Grant Count 19
R01 Count 14
Funding $4,254,795.12
PubMed Score 129.15
PubTator Score 101.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
osteosarcoma 2.377 0.000
ependymoma 1.100 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.400 0.001
group 4 medulloblastoma 1.300 0.000
medulloblastoma, large-cell 1.600 0.000
tuberculosis and treatment for 6 months 1.100 0.008
Breast cancer 1.100 0.000
ovarian cancer -1.200 0.000

Gene RIF (20)

PMID Text
26823701 Zinc finger protein x-linked contributes to patient prognosis, and regulates cell proliferation and apoptosis in human laryngeal squamous cell carcinoma.
26540164 ZFX expression may have a role in poor prognosis of renal cell carcinoma patients
26097576 Nasopharyngeal carcinoma patients with high ZFX expression had lower 5-year overall survival rates, progression-free survival rates, loco-regional relapse-free survival rates and distant metastasis-free survival rates than those with low ZFX expression
25916205 Our results provide evidence suggesting that ZFX overexpression is associated with the development of tongue SCC and ZFX knockdown is a potential treatment for tumor suppression
25441684 Study detected the expression of ZFX in 42 patients with renal cancer and found the expression of ZFX was specifically upregulated in cancer tissues at the mRNA and protein levels.
25355536 ZFX is essential for the development and progression of squamous cell carcinoma of the tongue.
25031734 our findings for the first time demonstrated that ZFX expression may be associated with the progress of colorectal cancer
24831540 These data demonstrate that ZFX functions as a critical upstream regulator of c-Myc and plays essential roles in the maintenance of the glioma stem cells phenotype
24585547 Expression of ZFX promotes tumor growth in hepatocellular carcinoma.
24228108 ZFX knockdown prevented tumor cell growth and migration in vitro and decreased proportion of tumor bearing mice and reduced mean tumor volume in a subcutaneous tumor model.
More...

AA Sequence

MDEDGLELQQEPNSFFDATGADGTHMDGDQIVVEVQETVFVSDVVDSDITVHNFVPDDPDSVVIQDVIED      1 - 70
VVIEDVQCPDIMEEADVSETVIIPEQVLDSDVTEEVSLAHCTVPDDVLASDITSASMSMPEHVLTGDSIH     71 - 140
VSDVGHVGHVGHVEHVVHDSVVEAEIVTDPLTTDVVSEEVLVADCASEAVIDANGIPVDQQDDDKGNCED    141 - 210
YLMISLDDAGKIEHDGSSGMTMDTESEIDPCKVDGTCPEVIKVYIFKADPGEDDLGGTVDIVESEPENDH    211 - 280
GVELLDQNSSIRVPREKMVYMTVNDSQPEDEDLNVAEIADEVYMEVIVGEEDAAAAAAAAAVHEQQMDDN    281 - 350
EIKTFMPIAWAAAYGNNSDGIENRNGTASALLHIDESAGLGRLAKQKPKKRRRPDSRQYQTAIIIGPDGH    351 - 420
PLTVYPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYRCTDCDYTTNKKISLHNHLESHKLTSKAEKAIEC    421 - 490
DECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSKNFPHICVECGKGFRHP    491 - 560
SELKKHMRIHTGEKPYQCQYCEYRSADSSNLKTHVKTKHSKEMPFKCDICLLTFSDTKEVQQHALIHQES    561 - 630
KTHQCLHCDHKSSNSSDLKRHIISVHTKDYPHKCDMCDKGFHRPSELKKHVAAHKGKKMHQCRHCDFKIA    631 - 700
DPFVLSRHILSVHTKDLPFRCKRCRKGFRQQSELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIH    701 - 770
TKDYPHRCEYCKKGFRRPSEKNQHIMRHHKEVGLP                                       771 - 805
//

Text Mined References (38)

PMID Year Title
27365365 2016 Diverse alternative back-splicing and alternative splicing landscape of circular RNAs.
26823701 2015 Zinc finger protein x-linked (ZFX) contributes to patient prognosis, cell proliferation and apoptosis in human laryngeal squamous cell carcinoma.
26540164 2015 ZFX is a Strong Predictor of Poor Prognosis in Renal Cell Carcinoma.
26097576 2015 High expression of Zinc-finger protein X-linked is associated with reduced E-cadherin expression and unfavorable prognosis in nasopharyngeal carcinoma.
25916205 2015 Dysregulation of zinc finger protein, X-linked (ZFX) impairs cell proliferation and induces apoptosis in human oral squamous cell carcinorma.
25441684 Knockdown of ZFX suppresses renal carcinoma cell growth and induces apoptosis.
25355536 2015 Overexpression of ZFX and its involvement in squamous cell carcinoma of the tongue.
25031734 2014 Zinc-finger protein X-linked is a novel predictor of prognosis in patients with colorectal cancer.
24831540 2014 The zinc finger transcription factor ZFX is required for maintaining the tumorigenic potential of glioblastoma stem cells.
24585547 2014 Overexpression of ZFX confers self-renewal and chemoresistance properties in hepatocellular carcinoma.
More...