Property Summary

NCBI Gene PubMed Count 196
PubMed Score 824.22
PubTator Score 282.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.287 1.2e-03
adult high grade glioma -1.200 7.5e-04
astrocytic glioma -1.500 5.3e-03
Breast cancer 1.100 1.6e-06
ductal carcinoma in situ 1.100 1.3e-02
ependymoma -2.100 1.0e-02
glioblastoma -1.100 1.3e-02
intraductal papillary-mucinous carcinoma... 1.100 8.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 4.2e-02
invasive ductal carcinoma 1.300 1.4e-03
lung cancer 2.900 3.6e-06
lung carcinoma 1.400 7.4e-26
malignant mesothelioma 1.400 5.4e-06
nasopharyngeal carcinoma 1.200 4.8e-05
oligodendroglioma -1.600 9.9e-03
ovarian cancer 1.300 1.6e-03
Pilocytic astrocytoma -1.100 6.6e-05
pituitary cancer 1.300 1.6e-06
subependymal giant cell astrocytoma -1.122 4.7e-02

Protein-protein Interaction (4)

Gene RIF (152)

AA Sequence

MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLK      1 - 70
QLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESK     71 - 140
DPADETEAD                                                                 141 - 149
//

Text Mined References (213)

PMID Year Title