Property Summary

NCBI Gene PubMed Count 178
Grant Count 146
R01 Count 80
Funding $56,766,318.24
PubMed Score 768.84
PubTator Score 282.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
astrocytoma -1.600 0.001
ependymoma -2.100 0.010
oligodendroglioma -1.600 0.010
glioblastoma -1.100 0.013
adrenocortical carcinoma 1.287 0.001
intraductal papillary-mucinous carcinoma... 1.100 0.009
intraductal papillary-mucinous neoplasm ... 1.100 0.042
lung cancer 2.900 0.000
adult high grade glioma -1.200 0.001
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -1.122 0.047
nasopharyngeal carcinoma 1.200 0.000
Breast cancer 2.100 0.000
lung carcinoma 1.400 0.000
ductal carcinoma in situ 1.100 0.013
invasive ductal carcinoma 1.300 0.001
ovarian cancer 1.300 0.002
pituitary cancer 1.300 0.000

Synonym

Accession P16949 A2A2D1 B2R4E7 B7Z8N4 D3DPJ5
Symbols Lag
SMN
OP18
PP17
PP19
PR22
LAP18
C1orf215

Gene

Gene RIF (136)

PMID Text
26802649 After silencing stathmin-1 in gastric cancer cells, the resistance index was reduced.
26466335 FANCC interacts and co-localizes with STMN1 at centrosomes during mitosis. We also showed that FANCC is required for STMN1 phosphorylation.
26450904 Studies indicate that phosphorylation of stathmin controls its biological activity by reducing its affinity for tubulin and hence preventing microtubule disassembly.
26356819 Data suggest that stathmin 1 silencing or paclitaxel treatment, combined with ruxolitinib could be an effective strategy for promoting apoptosis in Janus kinase 2 (JAK2 V617F) cells.
26272359 stathmin-1 may play a key role in regulating trophoblast invasion
26235036 STMN1 may play an important role in the development and tumor progression of cutaneous squamous cell carcinoma
26220844 Rare TT genotype of STMN1 gene may be an unfavorable predictive factor of chemotherapy based on platinum compounds and vinorelbine, in patients with NSCLC.
26148901 SNP in STMN1 gene may have a potential predictive role in taxane-based chemotherapy in advanced non-small cell lung cancer.
26087399 Results show that the STMN1-E/P/C signature is a reliable prognostic indicator for luminal subtype breast cancer and may predict the therapeutic response to paclitaxel-based treatments, potentially facilitating individualized management.
26045786 Report that STMN1 is a highly sensitive marker for leiomyosarcoma but is suboptimally specific for diagnostic purposes.
More...

AA Sequence

MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLK      1 - 70
QLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESK     71 - 140
DPADETEAD                                                                 141 - 149
//

Text Mined References (195)

PMID Year Title
26802649 2016 Enhancement of Chemosensitivity by Stathmin-1 Silencing in Gastric Cancer Cells In Situ and In Vivo.
26466335 2015 The Fanconi Anemia C Protein Binds to and Regulates Stathmin-1 Phosphorylation.
26450904 2015 Stathmin drives virus-induced metastasis.
26356819 2015 Stathmin 1 inhibition amplifies ruxolitinib-induced apoptosis in JAK2V617F cells.
26272359 2015 Decreased stathmin-1 expression inhibits trophoblast proliferation and invasion and is associated with recurrent miscarriage.
26235036 2015 STMN1 overexpression correlates with biological behavior in human cutaneous squamous cell carcinoma.
26220844 2015 Predictive value of STMN1 gene promoter polymorphism (-2166T>C) in patients with advanced NSCLC treated with the combination of platinum compounds and vinorelbine.
26148901 2016 Retrospective analysis of second-line chemotherapy outcomes with paclitaxel or docetaxel in correlation with STMN1 polymorphism in advanced non-small cell lung cancer patients.
26087399 2015 Stathmin and phospho-stathmin protein signature is associated with survival outcomes of breast cancer patients.
26045786 2015 An immunohistochemical analysis of stathmin 1 expression in uterine smooth muscle tumors: differential expression in leiomyosarcomas and leiomyomas.
More...