Property Summary

NCBI Gene PubMed Count 48
PubMed Score 253.31
PubTator Score 193.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Tyrosinemias 3 0.0 0.0
Disease Target Count Z-score Confidence
Tyrosinemia 10 7.92 4.0
Disease Target Count
Tyrosinemia type I 4

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer 1.100 3.3e-05
ductal carcinoma in situ -1.500 7.4e-03
ependymoma -1.300 3.5e-02
group 3 medulloblastoma -1.600 3.3e-03
invasive ductal carcinoma -1.400 4.6e-02
malignant mesothelioma -1.400 5.4e-07
medulloblastoma, large-cell -1.500 4.4e-04
osteosarcoma -1.222 8.3e-03
ovarian cancer -1.300 1.7e-03
pancreatic ductal adenocarcinoma liver m... -2.151 9.1e-03
psoriasis -1.100 3.2e-03
subependymal giant cell astrocytoma 1.301 1.8e-02

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (13)

AA Sequence

MSFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQDVFNQPTLNSF      1 - 70
MGLGQAAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQASATMHLPATIGDYTDFYSSRQHATNVGIM     71 - 140
FRDKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPDDSKPPVYGACKLLDMELEMAFFVGPGN    141 - 210
RLGEPIPISKAHEHIFGMVLMNDWSARDIQKWEYVPLGPFLGKSFGTTVSPWVVPMDALMPFAVPNPKQD    211 - 280
PRPLPYLCHDEPYTFDINLSVNLKGEGMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGT    281 - 350
ISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGDEVIITGYCQGDGYRIGFGQCAGKVLPALLPS     351 - 419
//

Text Mined References (55)

PMID Year Title