Property Summary

NCBI Gene PubMed Count 103
Grant Count 79
R01 Count 60
Funding $5,451,003.29
PubMed Score 233.16
PubTator Score 116.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
osteosarcoma -2.545 0.000
colon cancer -1.100 0.037
lung cancer -2.900 0.004
interstitial cystitis 1.800 0.001
primary Sjogren syndrome 1.600 0.000
subependymal giant cell astrocytoma 1.349 0.009
nasopharyngeal carcinoma -1.100 0.005
lung carcinoma -1.500 0.000
spina bifida 1.084 0.036
ulcerative colitis 1.500 0.002

Synonym

Accession P16885 D3DUL3 Q3ZTS2 Q59H45 Q969T5
Symbols FCAS3
APLAID
PLC-IV
PLC-gamma-2

Gene

PDB

2W2X   2K2J   2W2W  

Gene RIF (49)

PMID Text
25972157 Characterization of the effect of missense point-mutation at R665W in PLCG2 on signaling mechanisms of ibrutinib resistance in chronic lymphocytic leukemia cells.
25349203 PLCG2 missense mutation is a risk factor in the development of steroid sensitive nephrotic syndrome in childhood.
25227611 The autoinhibitory C-terminal SH2 domain of phospholipase C-gamma2 stabilizes B cell receptor signalosome assembly.
25012946 Data show that phospholipase Cgamma2 (PLCgamma2) is strongly expressed in B cell non-Hodgkin lymphoma and especially in a large subset of Diffuse large B-cell lymphoma (DLBCL).
24869598 identified three distinct mutations in PLCgamma2 in two patients resistant to ibrutinib
24868545 amarogentin prevents platelet activation through the inhibition of PLC gamma2-PKC cascade and MAPK pathway
24489640 The relationship between upstream tyrosine kinase SYK and its target, PLCgamma2, is maximally predictive and sufficient to distinguish chronic lymphocytic leukemia from healthy controls.
24166973 early Ca(2+) fluxing provides feed-forward signal amplification by promoting anchoring of the PLCgamma2 C2 domain to phospho-SLP65.
24127488 down-regulation of PLCgamma2-beta-catenin pathway occurs in mice and humans and leads to myeloid-derived suppressor cells-mediated tumor expansion.
24080446 Single-nucleotide polymorphisms in PLCG2 gene is associated with breast cancer risk after menopausal hormone replacement therapy.
More...

AA Sequence

MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADKIEGFLDIMEI      1 - 70
KEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAVNWLSGLKILHQEAMNASTPT     71 - 140
IIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLM    141 - 210
FEQQKSILDEFKKDSSVFILGNTDRPDASAVYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRET    211 - 280
AEPFLFVDEFLTYLFSRENSIWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLR    281 - 350
MGCRCIELDCWDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKA    351 - 420
FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQK    421 - 490
WTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKRTSAEKLLQEYCMETGGKDGT    491 - 560
FLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYYLTDNLTFSSIYALIQHYRETHLRCAEFELR    561 - 630
LTDPVPNPNPHESKPWYYDSLSRGEAEDMLMRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGR    631 - 700
HFVLGTSAYFESLVELVSYYEKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMP    701 - 770
QRTVKALYDYKAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQII    771 - 840
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWFQSIREITWKI    841 - 910
DTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETKADSIIRQKPVDLLKYNQK    911 - 980
GLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKYMQMNHALFSLNGRTGYVLQPESMRTEKYDP    981 - 1050
MPPESQRKILMTLTVKVLGARHLPKLGRSIACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKV   1051 - 1120
TFEIYDPNLAFLRFVVYEEDMFSDPNFLAHATYPIKAVKSGFRSVPLKNGYSEDIELASLLVFCEMRPVL   1121 - 1190
ESEEELYSSCRQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSN   1191 - 1260
SKFYS                                                                    1261 - 1265
//

Text Mined References (107)

PMID Year Title
25972157 2015 Hypermorphic mutation of phospholipase C, ?2 acquired in ibrutinib-resistant CLL confers BTK independency upon B-cell receptor activation.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25349203 2015 HLA-DQA1 and PLCG2 Are Candidate Risk Loci for Childhood-Onset Steroid-Sensitive Nephrotic Syndrome.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25227611 2014 The autoinhibitory C-terminal SH2 domain of phospholipase C-?2 stabilizes B cell receptor signalosome assembly.
25012946 2015 Expression and pro-survival function of phospholipase C?2 in diffuse large B-cell lymphoma.
24869598 2014 Resistance mechanisms for the Bruton's tyrosine kinase inhibitor ibrutinib.
24868545 2014 Amarogentin, a secoiridoid glycoside, abrogates platelet activation through PLC ? 2-PKC and MAPK pathways.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
More...