Property Summary

NCBI Gene PubMed Count 222
Grant Count 210
R01 Count 118
Funding $20,851,600.06
PubMed Score 528.61
PubTator Score 414.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
ulcerative colitis 3.700 0.000
malignant mesothelioma 3.400 0.000
psoriasis 2.000 0.005
cutaneous lupus erythematosus 3.000 0.000
osteosarcoma -2.347 0.032
chronic lymphosyte leukemia -1.100 0.000
cystic fibrosis 1.301 0.002
Atopic dermatitis 1.900 0.002
tuberculosis and treatment for 6 months -2.000 0.000
non-small cell lung carcinoma -1.200 0.000
lung cancer -4.000 0.000
interstitial cystitis 1.600 0.041
lung adenocarcinoma -1.800 0.000
adult high grade glioma 1.100 0.017
primary Sjogren syndrome 2.800 0.000
sarcoidosis -1.200 0.000
lung carcinoma -5.300 0.000
Breast cancer 2.200 0.031
gastric carcinoma 1.600 0.034
acute myeloid leukemia -1.500 0.042
ovarian cancer 2.600 0.004
pituitary cancer -1.600 0.000

Synonym

Accession P16871 B2RCS6 B4DVT1 Q05CU8 Q6NSP4 Q6NWM0 Q6NWM1 Q6NWM2 Q6NWM3 Q6SV45 Q9UPC1 IL-7 receptor subunit alpha
Symbols ILRA
CD127
IL7RA
CDW127
IL-7R-alpha

Gene

PDB

3DI2   3DI3   3UP1  

Gene RIF (221)

PMID Text
26974155 results suggest that LNK suppresses IL-7R/JAK/STAT signaling to restrict pro-/pre-B progenitor expansion and leukemia development, providing a pathogenic mechanism and a potential therapeutic approach for B-ALLs with LNK mutations.
26852660 Immunophenotyping with CD135 and CD117 predicts the FLT3, IL-7R and TLX3 gene mutations in childhood T-cell acute leukemia.
26499378 Data suggest that the lack of IL-7 receptor alpha chain (IL7Ralpha) expression, associated with hypermethylation of the IL7R promoter, in T cells restricts T-cell development in Schimke immuno-osseous dysplasia (SIOD) patients.
26425877 Pretransplant recipient circulating CD4+CD127lo/-TNFR2+ Treg cell is potentially a simpler alternative to Treg cell function as a pretransplant recipient immune marker for acute kidney injury.
26408663 cooperation between IL-7R and alpha2beta1 integrin can represent an important pathogenic pathway in Th17-osteoclast function associated with inflammatory diseases
26333292 A decrease of CD4(+) CD25(+) CD127(low) FoxP3(+) regulatory T cells with impaired suppressive function had been found in untreated ulcerative colitis patients.
26272555 this study shows that in human CD8 T cells that IL-7 binding to its receptor induces CD127 internalization via clathrin-mediated endocytosis, transport of the receptor from early to late endosomes and ultimately degradation of CD127 by the proteasome.
26123418 A girl with severe combined immunodeficiency was a compound heterozygote for 2 new frameshift mutations, c.589_598del10 p.P197fsX44 and c.993delA p.Q331fsX2. Each parent carried one of these.
26100671 Findings indicate that IL7 receptor (IL7R) and c-myc expression as intrinsic biomarkers that can predict the fate of CD8+ T effector cells after adoptive transfer.
25986373 Substitution of the first 10 Nterminal residues or deletion of residues 17-21 prevented Tat from interacting with and down regulating CD127 from the cell surface.
More...

AA Sequence

MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLE      1 - 70
FEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVIYR     71 - 140
EGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPD    141 - 210
HYFKGFWSEWSPSYYFRTPEINNSSGEMDPILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHK    211 - 280
KTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCP    281 - 350
SEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS    351 - 420
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ                                   421 - 459
//

Text Mined References (224)

PMID Year Title
26974155 2016 LNK/SH2B3 regulates IL-7 receptor signaling in normal and malignant B-progenitors.
26852660 2016 Immunophenotyping with CD135 and CD117 predicts the FLT3, IL-7R and TLX3 gene mutations in childhood T-cell acute leukemia.
26499378 2015 Lack of IL7R? expression in T cells is a hallmark of T-cell immunodeficiency in Schimke immuno-osseous dysplasia (SIOD).
26425877 2016 Pretransplant Recipient Circulating CD4+CD127lo/- Tumor Necrosis Factor Receptor 2+ Regulatory T Cells: A Surrogate of Regulatory T Cell-Suppressive Function and Predictor of Delayed and Slow Graft Function After Kidney Transplantation.
26408663 2015 Cooperation between IL-7 Receptor and Integrin ?2?1 (CD49b) Drives Th17-Mediated Bone Loss.
26333292 2015 Decrease of CD4(+) CD25(+) CD127(low) FoxP3(+) regulatory T cells with impaired suppressive function in untreated ulcerative colitis patients.
26272555 2016 IL-7 induces clathrin-mediated endocytosis of CD127 and subsequent degradation by the proteasome in primary human CD8 T cells.
26123418 2015 Hypomorphic interleukin-7 receptor ?-chain mutations and T-cell deficiency: a delay in diagnosis.
26100671 2015 Tumor-Specific Effector CD8+ T Cells That Can Establish Immunological Memory in Humans after Adoptive Transfer Are Marked by Expression of IL7 Receptor and c-myc.
25986373 2015 The N-Terminal Region of HIV-1 Tat Protein Binds CD127 in Human CD8 T Cells to Target the Receptor for Down Regulation Through Tat's Basic Region.
More...