Property Summary

NCBI Gene PubMed Count 243
PubMed Score 546.96
PubTator Score 414.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Melanoma 711 0.0 0.5

Expression

  Differential Expression (22)

Disease log2 FC p
ulcerative colitis 3.000 6.8e-07
acute myeloid leukemia -1.500 4.2e-02
adult high grade glioma 1.100 1.7e-02
Atopic dermatitis 1.900 2.5e-03
Breast cancer -1.600 1.6e-05
chronic lymphosyte leukemia -1.100 1.5e-04
cutaneous lupus erythematosus 3.000 3.0e-04
cystic fibrosis 1.301 1.9e-03
gastric carcinoma 1.600 3.4e-02
interstitial cystitis 1.300 4.9e-02
lung adenocarcinoma -1.400 6.3e-06
lung cancer -3.700 2.7e-06
lung carcinoma -5.300 3.2e-38
malignant mesothelioma 3.400 2.7e-08
non-small cell lung cancer -1.138 1.6e-06
osteosarcoma 1.932 4.1e-02
ovarian cancer -1.800 7.4e-04
pituitary cancer -1.600 2.2e-06
primary Sjogren syndrome 2.800 1.3e-04
psoriasis 1.300 6.7e-06
sarcoidosis -1.200 9.6e-06
tuberculosis -1.300 5.4e-03

Gene RIF (240)

AA Sequence

MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLE      1 - 70
FEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVIYR     71 - 140
EGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPD    141 - 210
HYFKGFWSEWSPSYYFRTPEINNSSGEMDPILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHK    211 - 280
KTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCP    281 - 350
SEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS    351 - 420
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ                                   421 - 459
//

Text Mined References (245)

PMID Year Title