Property Summary

NCBI Gene PubMed Count 222
PubMed Score 528.61
PubTator Score 414.85

Knowledge Summary


No data available


  Disease Sources (7)

Disease Target Count P-value
lung carcinoma 2844 3.21910204324505E-38
non-small cell lung carcinoma 413 2.9421265555945E-15
malignant mesothelioma 3163 2.69497105378591E-8
lung adenocarcinoma 2714 1.45352437924131E-6
pituitary cancer 1972 2.15423700602839E-6
lung cancer 4473 3.42205472655444E-6
sarcoidosis 368 9.62931847613569E-6
tuberculosis and treatment for 6 months 686 6.01557730378691E-5
primary Sjogren syndrome 789 1.32068415845031E-4
chronic lymphosyte leukemia 232 1.45599123087423E-4
cutaneous lupus erythematosus 1056 3.02666661736749E-4
cystic fibrosis 1670 0.00189911205488181
Atopic dermatitis 944 0.00248516785396147
ovarian cancer 8492 0.00374326852427596
psoriasis 6685 0.004758370636641
adult high grade glioma 2148 0.0168223724965342
Breast cancer 3099 0.0313596210725524
osteosarcoma 7933 0.0316932926459461
gastric carcinoma 832 0.0344560933564037
interstitial cystitis 2299 0.0411177317429854
acute myeloid leukemia 785 0.0421689010269676
Disease Target Count Z-score Confidence
Severe Combined Immunodeficiency 46 4.496 2.2


  Differential Expression (22)

Disease log2 FC p
ulcerative colitis 3.700 0.000
malignant mesothelioma 3.400 0.000
psoriasis 2.000 0.005
cutaneous lupus erythematosus 3.000 0.000
osteosarcoma -2.347 0.032
chronic lymphosyte leukemia -1.100 0.000
cystic fibrosis 1.301 0.002
Atopic dermatitis 1.900 0.002
tuberculosis and treatment for 6 months -2.000 0.000
non-small cell lung carcinoma -1.200 0.000
lung cancer -4.000 0.000
interstitial cystitis 1.600 0.041
lung adenocarcinoma -1.800 0.000
adult high grade glioma 1.100 0.017
primary Sjogren syndrome 2.800 0.000
sarcoidosis -1.200 0.000
lung carcinoma -5.300 0.000
Breast cancer 2.200 0.031
gastric carcinoma 1.600 0.034
acute myeloid leukemia -1.500 0.042
ovarian cancer 2.600 0.004
pituitary cancer -1.600 0.000


Accession P16871 B2RCS6 B4DVT1 Q05CU8 Q6NSP4 Q6NWM0 Q6NWM1 Q6NWM2 Q6NWM3 Q6SV45 Q9UPC1 IL-7 receptor subunit alpha
Symbols ILRA



3DI2   3DI3   3UP1  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid

Gene RIF (217)

26974155 results suggest that LNK suppresses IL-7R/JAK/STAT signaling to restrict pro-/pre-B progenitor expansion and leukemia development, providing a pathogenic mechanism and a potential therapeutic approach for B-ALLs with LNK mutations.
26852660 Immunophenotyping with CD135 and CD117 predicts the FLT3, IL-7R and TLX3 gene mutations in childhood T-cell acute leukemia.
26499378 Data suggest that the lack of IL-7 receptor alpha chain (IL7Ralpha) expression, associated with hypermethylation of the IL7R promoter, in T cells restricts T-cell development in Schimke immuno-osseous dysplasia (SIOD) patients.
26425877 Pretransplant recipient circulating CD4+CD127lo/-TNFR2+ Treg cell is potentially a simpler alternative to Treg cell function as a pretransplant recipient immune marker for acute kidney injury.
26408663 cooperation between IL-7R and alpha2beta1 integrin can represent an important pathogenic pathway in Th17-osteoclast function associated with inflammatory diseases
26333292 A decrease of CD4(+) CD25(+) CD127(low) FoxP3(+) regulatory T cells with impaired suppressive function had been found in untreated ulcerative colitis patients.
26272555 this study shows that in human CD8 T cells that IL-7 binding to its receptor induces CD127 internalization via clathrin-mediated endocytosis, transport of the receptor from early to late endosomes and ultimately degradation of CD127 by the proteasome.
26123418 A girl with severe combined immunodeficiency was a compound heterozygote for 2 new frameshift mutations, c.589_598del10 p.P197fsX44 and c.993delA p.Q331fsX2. Each parent carried one of these.
26100671 Findings indicate that IL7 receptor (IL7R) and c-myc expression as intrinsic biomarkers that can predict the fate of CD8+ T effector cells after adoptive transfer.
25986373 Substitution of the first 10 Nterminal residues or deletion of residues 17-21 prevented Tat from interacting with and down regulating CD127 from the cell surface.

AA Sequence

LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ                                   421 - 459

Text Mined References (224)

PMID Year Title
26974155 2016 LNK/SH2B3 regulates IL-7 receptor signaling in normal and malignant B-progenitors.
26852660 2016 Immunophenotyping with CD135 and CD117 predicts the FLT3, IL-7R and TLX3 gene mutations in childhood T-cell acute leukemia.
26499378 2015 Lack of IL7R? expression in T cells is a hallmark of T-cell immunodeficiency in Schimke immuno-osseous dysplasia (SIOD).
26425877 2016 Pretransplant Recipient Circulating CD4+CD127lo/- Tumor Necrosis Factor Receptor 2+ Regulatory T Cells: A Surrogate of Regulatory T Cell-Suppressive Function and Predictor of Delayed and Slow Graft Function After Kidney Transplantation.
26408663 2015 Cooperation between IL-7 Receptor and Integrin ?2?1 (CD49b) Drives Th17-Mediated Bone Loss.
26333292 2015 Decrease of CD4(+) CD25(+) CD127(low) FoxP3(+) regulatory T cells with impaired suppressive function in untreated ulcerative colitis patients.
26272555 2016 IL-7 induces clathrin-mediated endocytosis of CD127 and subsequent degradation by the proteasome in primary human CD8 T cells.
26123418 2015 Hypomorphic interleukin-7 receptor ?-chain mutations and T-cell deficiency: a delay in diagnosis.
26100671 2015 Tumor-Specific Effector CD8+ T Cells That Can Establish Immunological Memory in Humans after Adoptive Transfer Are Marked by Expression of IL7 Receptor and c-myc.
25986373 2015 The N-Terminal Region of HIV-1 Tat Protein Binds CD127 in Human CD8 T Cells to Target the Receptor for Down Regulation Through Tat's Basic Region.