Property Summary

NCBI Gene PubMed Count 62
PubMed Score 1019.84
PubTator Score 223.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma -1.517 3.1e-03
Atopic dermatitis -1.700 4.5e-04
atypical teratoid / rhabdoid tumor -2.700 1.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.426 2.2e-02
Breast cancer -1.200 7.2e-03
breast carcinoma -1.300 2.4e-21
cystic fibrosis 1.452 4.0e-04
Down syndrome 1.100 3.6e-03
Duchenne muscular dystrophy 1.027 2.1e-03
fascioscapulohumeral muscular dystrophy 1.110 3.5e-03
glioblastoma -1.400 3.1e-03
interstitial cystitis -1.400 8.6e-03
intraductal papillary-mucinous adenoma (... -2.100 2.0e-03
intraductal papillary-mucinous neoplasm ... -3.000 1.1e-03
invasive ductal carcinoma -1.318 1.9e-03
juvenile dermatomyositis 1.273 1.1e-07
lung cancer 1.700 1.6e-04
lung carcinoma 3.700 9.5e-34
medulloblastoma, large-cell -1.800 2.7e-05
oligodendroglioma 1.500 1.7e-03
osteosarcoma 3.629 5.9e-04
ovarian cancer -4.500 3.0e-15
pediatric high grade glioma -1.400 5.0e-04
primitive neuroectodermal tumor -1.600 5.6e-04
psoriasis -1.300 3.0e-05
type II diabetes mellitus and post-ische... 1.100 3.5e-02

Gene RIF (36)

AA Sequence

MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALVSVWLQC      1 - 70
TAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNE     71 - 140
TIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNH    141 - 210
LLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQS    211 - 280
LARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPP    281 - 350
EETLKTYWEDNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYK    351 - 420
LTASAPGYLAITKKVAVPYSPAAGVDFELESFSERKEEEKEELMEWWKMMSETLNF                  421 - 476
//

Text Mined References (63)

PMID Year Title