Property Summary

NCBI Gene PubMed Count 57
Grant Count 128
R01 Count 81
Funding $16,414,957.13
PubMed Score 983.11
PubTator Score 223.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P16870 A8K4N1 B3KR42 B4DFN4 D3DP33 Q9UIU9 CPE
Symbols CPH

Gene

CPE

PANTHER Protein Class (3)

Gene RIF (31)

PMID Text
26228366 Down-expression of liver carboxypeptidase E may reduce the secretion of serum cholecystokinin and contribute to the formation of cholesterol gallstone.
25374060 Downregulation of CPE regulates cell proliferation and chemosensitivity in pancreatic cancer.
24843127 Disruption of insulin receptor (IR) expression in beta cells has a direct impact on the expression of the convertase enzyme carboxypeptidase E (CPE) by inhibition of the eukaryotic translation initiation factor Eif4g1.
24006921 Upregulation of CPE promotes cell proliferation and tumorigenicity in colorectal cancer.
23852859 Data suggest that splice variant of carboxypeptidase E (CPE-DeltaN) that CPE-DeltaN expression might be a potential prognostic marker for colorectal cancer patients.
22998035 CPE is essential in the process and targeting of neuropeptides and neurotrophins, its participation in the pathological progression of Alzheimer's disease may be suggested
22824791 CPE forms a complex, probably through sequences located at its N-terminal domain, with Wnt3a and the extracellular cysteine rich domain of Fz1.
21628999 Neither high glucose nor insulin (with low glucose) regulates beta-cell CPE (but either up-regulates CPD).
21285511 an N-terminal truncated carboxypeptidase E splice isoform induces tumor growth and is a biomarker for predicting future metastasis in human cancers
21061162 CPE may play a role in promoting tumor growth and invasion.
More...

AA Sequence

MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALVSVWLQC      1 - 70
TAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNE     71 - 140
TIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNH    141 - 210
LLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQS    211 - 280
LARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPP    281 - 350
EETLKTYWEDNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYK    351 - 420
LTASAPGYLAITKKVAVPYSPAAGVDFELESFSERKEEEKEELMEWWKMMSETLNF                  421 - 476
//

Text Mined References (58)

PMID Year Title
26228366 The expression of hepatic carboxypeptidase E is decreased in patients with cholesterol gallstone.
25374060 2014 Downregulation of CPE regulates cell proliferation and chemosensitivity in pancreatic cancer.
24843127 2014 Insulin regulates carboxypeptidase E by modulating translation initiation scaffolding protein eIF4G1 in pancreatic ? cells.
24470285 2014 Carboxypeptidases in disease: insights from peptidomic studies.
24006921 2013 Upregulation of CPE promotes cell proliferation and tumorigenicity in colorectal cancer.
23852859 2013 Overexpression of CPE-?N predicts poor prognosis in colorectal cancer patients.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22998035 2013 Secretory sorting receptors carboxypeptidase E and secretogranin III in amyloid ?-associated neural degeneration in Alzheimer's disease.
22824791 2013 Carboxypeptidase E: a negative regulator of the canonical Wnt signaling pathway.
More...