Property Summary

NCBI Gene PubMed Count 922
PubMed Score 2242.78
PubTator Score 5280.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
cystic fibrosis -2.762 2.3e-07
permanent atrial fibrillation 1.500 1.6e-02

Gene RIF (905)

AA Sequence

MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQES      1 - 70
PRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH           71 - 134
//

Text Mined References (925)

PMID Year Title