Property Summary

NCBI Gene PubMed Count 852
Grant Count 263
R01 Count 137
Funding $38,809,146.53
PubMed Score 2101.72
PubTator Score 5280.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
permanent atrial fibrillation 1.500 0.016
cystic fibrosis -2.762 0.000

Synonym

Accession P16860 B0ZBE9 Q6FGY0 Q9P2Q7
Symbols BNP

Gene

PANTHER Protein Class (2)

PDB

1YK1   3N56  

Gene RIF (836)

PMID Text
27328498 Umbilical arterial NTproBNP levels were significantly higher in the pre-eclampsia, fetal growth restriction, preterm birth, and fetal distress groups than in the control group.
27328493 NTproBNP was decreased in the umbilical cord blood of fetuses with meconium stained amniotic fluid compared to controls.
27085779 Data suggest that low serum levels of NT-proBNP are an independent risk factor/biomarker for diagnosis of NAFLD; low serum levels of NT-proBNP correlate with presence of elevated fat accumulation in liver (in a multi-ethnic, cross-sectional study).
27077910 Data suggest testing for aminoterminal pro-B-type natriuretic peptide (NT-proBNP) should be performed in the hospitalized very elderly, because of the very high prevalence of underlying heart failure (HF) and its impact on in-hospital mortality.
26957276 BNP levels can be used as a clinical indicator to predict short-term prognosis in ST-elevation myocardial infarction patients.
26949703 Combined with hydration, exogenous brain natriuretic peptide administration before contrast media effectively decreases contrast-induced nephropathy incidence in chronic kidney disease patients
26868212 Obstructive CAD causing myocardial ischemia is associated with increased levels of NT-proBNP.
26852688 Recombinant human BNP attenuates trauma/haemorrhagic shock-induced acute lung injury by inhibiting oxidative stress and the NF-kappaB-dependent inflammatory/MMP-9 signaling pathway.
26845306 In cirrhotic patients, pre-liver transplant BNP serum level was an independent predictor of post-LT ICU mortality.
26801306 BNP levels rose after paroxysmal supraventricular tachycardia and continued to rise after the termination.
More...

AA Sequence

MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQES      1 - 70
PRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH           71 - 134
//

Text Mined References (855)

PMID Year Title
27328498 2016 Umbilical arterial N-terminal pro-B-type natriuretic peptide levels in preeclampsia, fetal growth restriction, preterm birth and fetal distress.
27328493 2016 N terminal-pro brain natriuretic peptide in fetal umbilical cord meconium-stained amniotic fluid: a prospective case control study.
27085779 2016 Computerized tomography measured liver fat is associated with low levels of N-terminal pro-brain natriuretic protein (NT-proBNP). Multi-Ethnic Study of Atherosclerosis.
27077910 2016 NT-proBNP and Its Correlation with In-Hospital Mortality in the Very Elderly without an Admission Diagnosis of Heart Failure.
26957276 2016 Relationship between B-type natriuretic peptide and short-term prognosis in non-diabetic patients with ST-segment elevation myocardial infarction.
26949703 2016 Recombinant Brain Natriuretic Peptide for the Prevention of Contrast-Induced Nephropathy in Patients with Chronic Kidney Disease Undergoing Nonemergent Percutaneous Coronary Intervention or Coronary Angiography: A Randomized Controlled Trial.
26868212 2016 Effect of Coronary Atherosclerosis and Myocardial Ischemia on Plasma Levels of High-Sensitivity Troponin T and NT-proBNP in Patients With Stable Angina.
26852688 2015 Recombinant human brain natriuretic peptide attenuates trauma-/haemorrhagic shock-induced acute lung injury through inhibiting oxidative stress and the NF-?B-dependent inflammatory/MMP-9 pathway.
26845306 2016 Prognostic Value of Preoperative Brain Natriuretic Peptide Serum Levels in Liver Transplantation.
26801306 2016 Responses of cardiac natriuretic peptides after paroxysmal supraventricular tachycardia: ANP surges faster than BNP and CNP.
More...