Property Summary

NCBI Gene PubMed Count 373
PubMed Score 375.99
PubTator Score 1253.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Immune system cancer 140 0.0 0.7
Lymphoid leukemia 160 0.0 0.7
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 2.8
Heart disease 306 0.0 1.2

Expression

  Differential Expression (33)

Disease log2 FC p
adrenocortical carcinoma 2.047 1.8e-03
aldosterone-producing adenoma -1.457 4.7e-02
Breast cancer -2.900 2.3e-02
breast carcinoma -2.200 6.6e-03
chronic lymphosyte leukemia -1.300 4.2e-07
colon cancer -1.900 1.7e-02
cutaneous lupus erythematosus 1.400 4.7e-03
cystic fibrosis 1.100 1.4e-03
ductal carcinoma in situ -3.300 1.9e-03
ependymoma 3.700 4.7e-02
fibroadenoma -3.200 1.1e-02
head and neck cancer -1.500 2.3e-02
hereditary spastic paraplegia -1.505 1.3e-02
intraductal papillary-mucinous adenoma (... -2.300 9.6e-05
intraductal papillary-mucinous carcinoma... -2.600 2.9e-05
intraductal papillary-mucinous neoplasm ... -2.500 1.3e-03
invasive ductal carcinoma -1.889 7.6e-03
juvenile dermatomyositis 1.026 9.6e-04
lung adenocarcinoma -2.000 6.3e-08
lung cancer -1.800 4.1e-04
lung carcinoma -3.500 1.7e-23
mucosa-associated lymphoid tissue lympho... 2.865 4.7e-03
non-small cell lung cancer -3.504 1.6e-27
osteosarcoma -1.817 1.7e-03
ovarian cancer -1.400 2.4e-06
pancreatic cancer 2.300 5.2e-04
pancreatic carcinoma 2.300 5.2e-04
pancreatic ductal adenocarcinoma liver m... -1.056 1.1e-02
Pneumonia 1.200 1.5e-02
psoriasis 1.600 3.6e-06
Rheumatoid arthritis 2.500 6.6e-03
tuberculosis 3.600 7.2e-09
uncontrolled asthma 1.400 3.6e-02

Protein-protein Interaction (3)

Gene RIF (344)

AA Sequence

MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDV      1 - 70
QNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNL     71 - 140
AVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADG    141 - 210
VYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE    211 - 280
SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYAS    281 - 350
PDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG    351 - 420
TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK                      421 - 472
//

Text Mined References (383)

PMID Year Title