Property Summary

NCBI Gene PubMed Count 335
PubMed Score 361.47
PubTator Score 1253.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
non-small cell lung cancer 2798 8.93669590725906E-31
lung carcinoma 2844 1.74556339048625E-23
breast carcinoma 1614 2.5369441746241E-21
posterior fossa group B ependymoma 1530 3.29200666705316E-17
ovarian cancer 8492 1.11952864491059E-8
tuberculosis 1563 1.12018892259514E-7
chronic lymphosyte leukemia 232 4.1836427056797E-7
lung adenocarcinoma 2714 4.91803731443362E-7
lung cancer 4473 5.28008557232566E-7
psoriasis 6685 1.00693130940651E-4
invasive ductal carcinoma 2950 1.15781725780791E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.26361329729506E-4
cystic fibrosis 1670 1.46070294673422E-4
osteosarcoma 7933 1.81275953168025E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.00447179937577E-4
pancreatic carcinoma 567 5.17586301088305E-4
pancreatic cancer 2300 5.17586301088314E-4
juvenile dermatomyositis 1189 9.5947295861237E-4
ductal carcinoma in situ 1745 0.00192515839440698
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0029789368640767
mucosa-associated lymphoid tissue lymphoma 480 0.00469485506741982
Rheumatoid Arthritis 1171 0.00659955934285097
adrenocortical carcinoma 1427 0.00717323123781505
cutaneous lupus erythematosus 1056 0.00821552114405962
fibroadenoma 557 0.0108169665806781
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0114108474380501
aldosterone-producing adenoma 664 0.0129476156053914
hereditary spastic paraplegia 313 0.0134605137534447
Pneumonia 133 0.0152404836539739
colon cancer 1475 0.0174984403270255
head and neck cancer 270 0.0227667188917674
Breast cancer 3099 0.0248609387717636
uncontrolled asthma 67 0.0362764521811159
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Heart disease 279 0.0 1.0
Disease Target Count
Platelet glycoprotein IV deficiency 1
Disease Target Count
Coronary heart disease 7 1

Expression

Synonym

Accession P16671 D9IX66 D9IX67 D9IX68 D9IX69 Q13966 Q16093 Q8TCV7 Q9BPZ8 Q9BQC2 Q9BZM8 Q9BZN3 Q9BZN4 Q9BZN5
Symbols FAT
GP4
GP3B
GPIV
CHDS7
PASIV
SCARB3
BDPLT10

Gene

PANTHER Protein Class (1)

PDB

5LGD  

  Ortholog (11)

Gene RIF (310)

PMID Text
26821945 Identify a CD36-mediated mechanistic pathway through which extracellular vesicles inhibit microvascular endothelial cell migration and tube formation.
26592663 Taken together, our study suggests that aging facilitates lesion development in apoE(-/-) mice with greater effect on male mice.
26556365 We report that rs1761667 polymorphism of CD36 gene and oro-gustatory thresholds for fat might play a significant role in the development of obesity in young teenagers.
26505798 These data suggest that inhibition of CD36 prevented high glucose - induced epithelial-to-mesenchymal transition in renal tubular epithelial cells, highlighting CD36 as a potential therapeutic target for diabetic nephropathy.
26504087 these results demonstrate that an interaction between STAT1, p300, and peroxisome proliferator-activated receptor-gamma is required for 15(S)-HETE-induced CD36 expression, oxidized low density lipoprotein uptake, and foam cell formation
26494228 PCSK9-mediated CD36 degradation may serve to limit fatty acid uptake and triglyceride accumulation in tissues, such as the liver and adipose tissue.
26424075 Elevated free fatty acid uptake via CD36 promotes epithelial-mesenchymal transition in hepatocellular carcinoma
26385579 Nrf2-driven CD36 and HO-1 expression on innate immune cells could contribute to a protective and detoxifying mechanism during pregnancy-associated malaria.
26269236 Data suggest that components of dietary fat (long-chain fatty acids) act as ligands for fatty acid translocase/CD36 and participate in regulation of intestinal absorption and the satiety response. [REVIEW]
26251134 We identified SR-BI to indicate human prostate cancer formation, suggesting that increased levels of SR-BI may be involved in the generation of a castration-resistant phenotype.
More...

AA Sequence

MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDV      1 - 70
QNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNL     71 - 140
AVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADG    141 - 210
VYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE    211 - 280
SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYAS    281 - 350
PDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG    351 - 420
TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK                      421 - 472
//

Text Mined References (344)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26821945 2016 Extracellular Vesicles Activate a CD36-Dependent Signaling Pathway to Inhibit Microvascular Endothelial Cell Migration and Tube Formation.
26592663 2016 Impact of age and sex on the development of atherosclerosis and expression of the related genes in apoE deficient mice.
26556365 2015 Oral Fat Sensing and CD36 Gene Polymorphism in Algerian Lean and Obese Teenagers.
26505798 2015 CD36 is involved in high glucose-induced epithelial to mesenchymal transition in renal tubular epithelial cells.
26504087 2015 Reactive Oxygen Species (ROS) Mediate p300-dependent STAT1 Protein Interaction with Peroxisome Proliferator-activated Receptor (PPAR)-? in CD36 Protein Expression and Foam Cell Formation.
26494228 2015 PCSK9 Induces CD36 Degradation and Affects Long-Chain Fatty Acid Uptake and Triglyceride Metabolism in Adipocytes and in Mouse Liver.
26424075 2015 Elevated free fatty acid uptake via CD36 promotes epithelial-mesenchymal transition in hepatocellular carcinoma.
26385579 2015 Nrf2-driven CD36 and HO-1 gene expression in circulating monocytes correlates with favourable clinical outcome in pregnancy-associated malaria.
26269236 2015 Dietary Lipids Inform the Gut and Brain about Meal Arrival via CD36-Mediated Signal Transduction.
More...