Property Summary

NCBI Gene PubMed Count 335
Grant Count 74
R01 Count 57
Funding $8,103,297.38
PubMed Score 361.47
PubTator Score 1253.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (57)

Disease Z-score Confidence
Obesity 616 3.778 1.9
diabetes mellitus 1,663 3.307 1.7
Coronary artery disease 240 3.282 1.6
Malaria 140 3.261 1.6
Acquired metabolic disease 267 2.0
Breast cancer 3,094
CORONARY HEART DISEASE, SUSCEPTIBILITY T... 1 
Cardiomyopathy, Dilated 47
Coronary heart disease 59
Dermatitis, Allergic Contact 66
Heart disease 279 1.0
Hypertensive disease 193
IGA Glomerulonephritis 454
Immunologic Deficiency Syndromes 16
Impaired glucose tolerance 12
Insulin Resistance 48
MALARIA, CEREBRAL, RESISTANCE TO 2
MALARIA, CEREBRAL, SUSCEPTIBILITY TO (fi... 3 
Myocardial Ischemia 169
PLASMODIUM FALCIPARUM BLOOD INFECTION LE... 4 
Platelet Glycoprotein IV Deficiency 1
Platelet mean volume finding 31
Pneumonia 133
Reperfusion Injury 84
Rheumatoid Arthritis 1,160
Staphylococcal Infections 4
Weight Gain 87
adrenocortical carcinoma 1,427
aldosterone-producing adenoma 664
breast carcinoma 1,614
chronic lymphosyte leukemia 232
colon cancer 1,475
cutaneous lupus erythematosus 1,056
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
fibroadenoma 557
head and neck cancer 270
hereditary spastic paraplegia 313
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
mucosa-associated lymphoid tissue lympho... 480 
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pancreatic ductal adenocarcinoma liver m... 1,795 
posterior fossa group B ependymoma 1,530
psoriasis 6,685
tuberculosis 1,557
uncontrolled asthma 67

Expression

Synonym

Accession P16671 D9IX66 D9IX67 D9IX68 D9IX69 Q13966 Q16093 Q8TCV7 Q9BPZ8 Q9BQC2 Q9BZM8 Q9BZN3 Q9BZN4 Q9BZN5
Symbols FAT
GP4
GP3B
GPIV
CHDS7
PASIV
SCARB3
BDPLT10

Gene

PANTHER Protein Class (1)

PDB

5LGD  

Gene RIF (313)

PMID Text
26821945 Identify a CD36-mediated mechanistic pathway through which extracellular vesicles inhibit microvascular endothelial cell migration and tube formation.
26592663 Taken together, our study suggests that aging facilitates lesion development in apoE(-/-) mice with greater effect on male mice.
26556365 We report that rs1761667 polymorphism of CD36 gene and oro-gustatory thresholds for fat might play a significant role in the development of obesity in young teenagers.
26505798 These data suggest that inhibition of CD36 prevented high glucose - induced epithelial-to-mesenchymal transition in renal tubular epithelial cells, highlighting CD36 as a potential therapeutic target for diabetic nephropathy.
26504087 these results demonstrate that an interaction between STAT1, p300, and peroxisome proliferator-activated receptor-gamma is required for 15(S)-HETE-induced CD36 expression, oxidized low density lipoprotein uptake, and foam cell formation
26494228 PCSK9-mediated CD36 degradation may serve to limit fatty acid uptake and triglyceride accumulation in tissues, such as the liver and adipose tissue.
26424075 Elevated free fatty acid uptake via CD36 promotes epithelial-mesenchymal transition in hepatocellular carcinoma
26385579 Nrf2-driven CD36 and HO-1 expression on innate immune cells could contribute to a protective and detoxifying mechanism during pregnancy-associated malaria.
26269236 Data suggest that components of dietary fat (long-chain fatty acids) act as ligands for fatty acid translocase/CD36 and participate in regulation of intestinal absorption and the satiety response. [REVIEW]
26251134 We identified SR-BI to indicate human prostate cancer formation, suggesting that increased levels of SR-BI may be involved in the generation of a castration-resistant phenotype.
More...

AA Sequence

MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDV      1 - 70
QNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNL     71 - 140
AVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADG    141 - 210
VYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE    211 - 280
SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYAS    281 - 350
PDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG    351 - 420
TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK                      421 - 472
//

Text Mined References (344)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26821945 2016 Extracellular Vesicles Activate a CD36-Dependent Signaling Pathway to Inhibit Microvascular Endothelial Cell Migration and Tube Formation.
26592663 2016 Impact of age and sex on the development of atherosclerosis and expression of the related genes in apoE deficient mice.
26556365 2015 Oral Fat Sensing and CD36 Gene Polymorphism in Algerian Lean and Obese Teenagers.
26505798 2015 CD36 is involved in high glucose-induced epithelial to mesenchymal transition in renal tubular epithelial cells.
26504087 2015 Reactive Oxygen Species (ROS) Mediate p300-dependent STAT1 Protein Interaction with Peroxisome Proliferator-activated Receptor (PPAR)-? in CD36 Protein Expression and Foam Cell Formation.
26494228 2015 PCSK9 Induces CD36 Degradation and Affects Long-Chain Fatty Acid Uptake and Triglyceride Metabolism in Adipocytes and in Mouse Liver.
26424075 2015 Elevated free fatty acid uptake via CD36 promotes epithelial-mesenchymal transition in hepatocellular carcinoma.
26385579 2015 Nrf2-driven CD36 and HO-1 gene expression in circulating monocytes correlates with favourable clinical outcome in pregnancy-associated malaria.
26269236 2015 Dietary Lipids Inform the Gut and Brain about Meal Arrival via CD36-Mediated Signal Transduction.
More...