Property Summary

NCBI Gene PubMed Count 143
Grant Count 42
R01 Count 12
Funding $2,393,662.81
PubMed Score 210.69
PubTator Score 308.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ulcerative colitis -1.573 0.031
facioscapulohumeral dystrophy -2.200 0.010

Gene RIF (138)

PMID Text
26407805 UGT2B7 contributes to the in-vitro glucuronidation of arctigenin in liver/intestinal microsomes.
26303110 Influence of valproic acid concentration and polymorphism of UGT1A4*3, UGT2B7 -161C > T and UGT2B7*2 on serum concentration of lamotrigine in Chinese epileptic children
26220143 Kinetic analyses revealed very low Km value for 16alpha-hydroxyestrone glucuronidation by UGT2B7, below 4 muM, suggesting higher affinity than commonly found among UGTs and their substrates
26176234 This descriptive study examines correlations between concentrations of tamoxifen's glucuronide metabolites and genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 in 132 patients with estrogen receptor-positive breast cancer under treatment with tamoxifen
26088889 These results suggested that UGT2B7 C802T may be an important determinant of individual variability in the pharmacokinetics of VPA
26053558 aprepitant can alter clearance of drugs primarily eliminated by UGT2B7.
26010150 in tumor liver microsomes from HCC patients, either V(max) (maximum reaction rate, R(max) for UGT1A1) or clearance rates (V(max)/K(m), Clint) of UGT1A, UGT1A1, UGT1A4, UGT1A9 and UGT2B7 were lower than those in the adjacent normal liver microsomes
25935875 Results show ticagrelor pharmacokinetics to be influenced by SNPs in UGT2B7 though no detectable effects on efficacy or safety were found
25823783 This study revealed that three polymorphisms, SCN1A IVS5-91G>A, ABCC2 c.1249 G>A and UGT2B7 c.802T>C, are associated with OXC maintenance dose and lnCDR in Han Chinese epilepsy patients
25752520 Significant differences in mean dose consumption were seen among the genotypic groups of the OPRM1 A118G and UGT2B7 C802T variants. These variants were found to predict codeine consumption in the cohort overall and among Caucasians
More...

AA Sequence

MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSS      1 - 70
ALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKV     71 - 140
QESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMER    141 - 210
VKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPHPLLPNVDFVGGL    211 - 280
HCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLN    281 - 350
TRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTM    351 - 420
SSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHS    421 - 490
LDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND                                   491 - 529
//

Publication (146)

PMID Year Title
26407805 2015 Identification and characterization of human UDP-glucuronosyltransferases responsible for the in-vitro glucuronidation of arctigenin.
26303110 2015 Influence of valproic acid concentration and polymorphism of UGT1A4*3, UGT2B7 -161C?>?T and UGT2B7*2 on serum concentration of lamotrigine in Chinese epileptic children.
26220143 2015 Glucuronidation of estrone and 16?-hydroxyestrone by human UGT enzymes: The key roles of UGT1A10 and UGT2B7.
26176234 2015 Impacts of the Glucuronidase Genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 on Tamoxifen Metabolism in Breast Cancer Patients.
26088889 2015 The influence of UGT2B7 genotype on valproic acid pharmacokinetics in Chinese epilepsy patients.
26053558 2015 In vitro glucuronidation of aprepitant: a moderate inhibitor of UGT2B7.
26010150 2015 Drug-Metabolizing Activity, Protein and Gene Expression of UDP-Glucuronosyltransferases Are Significantly Altered in Hepatocellular Carcinoma Patients.
25935875 2015 Effect of genetic variations on ticagrelor plasma levels and clinical outcomes.
25823783 2015 SCN1A, ABCC2 and UGT2B7 gene polymorphisms in association with individualized oxcarbazepine therapy.
25752520 2015 The pharmacogenetics of codeine pain relief in the postpartum period.
More...