Property Summary

Ligand Count 27
NCBI Gene PubMed Count 149
PubMed Score 219.03
PubTator Score 308.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Urinary Bladder Neoplasms 114 0.0 0.0
Disease Target Count
Bladder Neoplasm 112
Disease Target Count P-value
ulcerative colitis 1819 9.8e-03
facioscapulohumeral dystrophy 288 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Pain agnosia 104 3.552 1.8
Cancer 2499 3.448 1.7
Epilepsy 792 3.261 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy -2.200 1.0e-02
ulcerative colitis -1.466 9.8e-03

Gene RIF (144)

AA Sequence

MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSS      1 - 70
ALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKV     71 - 140
QESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMER    141 - 210
VKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPHPLLPNVDFVGGL    211 - 280
HCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLN    281 - 350
TRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTM    351 - 420
SSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHS    421 - 490
LDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND                                   491 - 529
//

Text Mined References (152)

PMID Year Title