Property Summary

NCBI Gene PubMed Count 60
Grant Count 13
R01 Count 5
Funding $2,934,475.83
PubMed Score 51.08
PubTator Score 61.11

Knowledge Summary

Patent

No data available

Gene RIF (60)

PMID Text
24899193 HIV-1 Nef-stimulated CD8+ T cells upregulate mRNAs expression for IFN-gamma, MIP-1alpha, MIP-1alphaP, MIP-1beta, TNFRSF9, XCL1, and GM-CSF compared to unstimulated cells
24899193 HIV-1 Nef-stimulated CD8+ T cells upregulate mRNAs expression for IFN-gamma, MIP-1alpha, MIP-1alphaP, MIP-1beta, TNFRSF9, XCL1, and GM-CSF compared to unstimulated cells
24405814 no evidence for an influence of variation in genes coding for MIP-1alpha or CCR5 individually or together in susceptibility to clinically active TB
24219137 Studied copy number variation of the CCL3L1 gene in contributing to the host variation in susceptibility and response to HIV infection by analyzing a sub-Saharan African cohort.
23692808 HIV-1 Nef-stimulated CD8+ T cells upregulate mRNAs expression for IFN-gamma, MIP-1alpha, MIP-1alphaP, MIP-1beta, TNFRSF9, XCL1, and GM-CSF compared to unstimulated cells
23383108 HIV-1 Nef-stimulated CD8+ T cells upregulate mRNAs expression for IFN-gamma, MIP-1alpha, MIP-1alphaP, MIP-1beta, TNFRSF9, XCL1, and GM-CSF compared to unstimulated cells
22837109 Studies indicate beta-defensins (DEFB4, DEFB103, DEFB104), chemokine ligand 3 like 1 (CCL3L1), Fc gamma receptor 3B (FCGR3B), and complement component C4 (C4) for copy number variation in disease association.
22785612 The results do not support involvement of the CCL3L1 copy number variants in rheumatoid arthritis susceptibility.
22484763 Studied the copy number variation of the chemokine gene CCL3L1 with susceptibility to malaria. We identified a high level of copy number haplotype diversity and find some evidence for an association of low CCL3L1 copy number with protection from anaemia.
22484760 Examined a Zimbabwean study population for an association of CCL3L CNV with HIV status, progression and survival. Found no association between four CCL3L CNV strata and HIV status , CD4 T-cell count, viral load , or CCL3 protein levels.
More...

AA Sequence

MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRG      1 - 70
RQVCADPSEEWVQKYVSDLELSA                                                    71 - 93
//

Text Mined References (60)

PMID Year Title
24405814 2014 CCL3L1 copy number, CCR5 genotype and susceptibility to tuberculosis.
24219137 2013 CCL3L1 copy number, HIV load, and immune reconstitution in sub-Saharan Africans.
22837109 2013 Correlating multiallelic copy number polymorphisms with disease susceptibility.
22785612 2012 Association analysis of the CCL3L1 copy number locus by paralogue ratio test in Norwegian rheumatoid arthritis patients and healthy controls.
22484763 2012 CCL3L1 copy number and susceptibility to malaria.
22484760 2012 CCL3L gene copy number and survival in an HIV-1 infected Zimbabwean population.
22476153 2012 Functional effects of CCL3L1 copy number.
22450355 2012 Variations in the number of CCL3L1 gene copies and Kawasaki disease in Korean children.
21919959 Copy number variation in CCL3L1 gene is associated with susceptibility to acute rejection in patients after liver transplantation.
21816135 2011 Copy number variation of CCL3L1 influences asthma risk by modulating IL-10 expression.
More...