Property Summary

NCBI Gene PubMed Count 163
Grant Count 166
R01 Count 125
Funding $20,398,697.93
PubMed Score 681.45
PubTator Score 355.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (53)

Disease Z-score Confidence
Keratosis Follicularis 3 7.757 3.9
Hailey-Hailey disease 10 6.447 3.2
Acrokeratosis verruciformis 1 6.319 3.2
Heart disease 279 4.491 2.2
Glomangiomatosis 4 4.466 2.2
Brody myopathy 3 4.249 2.1
Tinea manuum 4 3.844 1.9
Epidermolytic hyperkeratosis 13 3.461 1.7
Eczema herpeticum 7 3.322 1.7
Dowling-Degos disease 6 3.253 1.6
Lichen nitidus 3 3.063 1.5
Frey Syndrome 4 3.021 1.5
Acrokeratosis Verruciformis of Hopf 1
Cardiomegaly 66
Darier Disease, Acral Hemorrhagic Type 1
Darier Disease, Segmental 1
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 157
Diabetic Cardiomyopathies 10
Epilepsy 346 4.0
Gaucher disease type 1 171
Heart Diseases 42
Heart failure 80
Myocardial Reperfusion Injury 34
Myocardial stunning 8
Pick disease 1,893
Schizophrenia 501
Status Epilepticus 85
Ventricular Dysfunction, Left 15
adrenocortical carcinoma 1,427
adult high grade glioma 2,148
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
colon cancer 1,475
ductal carcinoma in situ 1,745
ependymoma 2,514
glioblastoma 5,572
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
pituitary cancer 1,972
primitive neuroectodermal tumor 3,031
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287

Expression

Synonym

Accession P16615 A6NDN7 B4DF05 P16614 Q86VJ2 SERCA2
Symbols DD
DAR
ATP2B
SERCA2

Gene

PANTHER Protein Class (2)

Gene RIF (129)

PMID Text
27055500 CAPN3 deficiency leads to degradation of SERCA proteins and Ca2+ dysregulation in the skeletal muscle.
26743715 Phospholamban and sarcolipin are membrane proteins that differentially regulate SERCA function. (Review)
26608678 High SERCA2 expression is associated with colorectal cancer.
26607901 Inhibition of SERCA2 activity by curcumin disrupts the Ca(2+) homeostasis and thereby promotes apoptosis in ovarian cancer cells.
26051059 ATP2A2 mutation was found in patients diagnosed with Darier disease.
25880173 Quantification of SERCA2 mRNA or protein expression levels revealed no differences in airway smooth muscle cells obtained from subjects with asthma compared to non-asthmatic controls.
25872913 Two novel missense mutations, p.R603I and p.G749V, in the ATP2A2 gene in two families containing individuals diagnosed with Darier disease.
25661196 SERCA and PMCA pump activities are strongly affected by the localization of F508del-CFTR protein.
25593322 PDE3A is part of a SERCA2 signaling complex in cardiac myocytes.
25327883 Gene therapy in heart failure. SERCA2a as a therapeutic target.
More...

AA Sequence

MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDLLVRILLLAAC      1 - 70
ISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRI     71 - 140
KAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFS    141 - 210
GTNIAAGKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFN    211 - 280
DPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICS    281 - 350
DKTGTLTTNQMSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVNCHQYDGLVELATICALC    351 - 420
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMKKEFTLEFSRD    421 - 490
RKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGVKQKIMSVIREWGSGSDTLRC    491 - 560
LALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGT    561 - 630
AVAICRRIGIFGQDEDVTSKAFTGREFDELNPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMT    631 - 700
GDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGE    701 - 770
VVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIG    771 - 840
CYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCN    841 - 910
ALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMD    911 - 980
ETLKFVARNYLEPGKECVQPATKSCSFSACTDGISWPFVLLIMPLVIWVYSTDTNFSDMFWS            981 - 1042
//

Text Mined References (173)

PMID Year Title
27055500 2016 Calpain 3 deficiency affects SERCA expression and function in the skeletal muscle.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26743715 2016 Phospholamban and sarcolipin: Are they functionally redundant or distinct regulators of the Sarco(Endo)Plasmic Reticulum Calcium ATPase?
26608678 2015 Small molecule RL71 targets SERCA2 at a novel site in the treatment of human colorectal cancer.
26607901 2016 Curcumin induces apoptosis by inhibiting sarco/endoplasmic reticulum Ca2+ ATPase activity in ovarian cancer cells.
26051059 Darier disease: A fold (intertriginous) dermatosis.
25996873 2015 TMEM203 Is a Novel Regulator of Intracellular Calcium Homeostasis and Is Required for Spermatogenesis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25880173 2015 No evidence for altered intracellular calcium-handling in airway smooth muscle cells from human subjects with asthma.
25872913 2015 Identification of two novel Darier disease?associated mutations in the ATP2A2 gene.
More...