Property Summary

Ligand Count 9
NCBI Gene PubMed Count 70
PubMed Score 55.45
PubTator Score 40.75

Knowledge Summary

Patent (46,693)

TINX Plot

  Disease (5)

Disease Target Count P-value
lung adenocarcinoma 2716 2.8e-19
ovarian cancer 8520 3.0e-14
osteosarcoma 7950 6.5e-04
invasive ductal carcinoma 2951 1.1e-03
diabetes mellitus 1728 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Disease of metabolism 18 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 3.244 1.6
Disease Target Count Z-score Confidence
Gamma chain deficiency 7 3.306 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.200 2.0e-03
invasive ductal carcinoma -1.400 1.1e-03
lung adenocarcinoma -1.400 2.8e-19
osteosarcoma 1.535 6.5e-04
ovarian cancer -2.300 3.0e-14

 MGI Phenotype (1)

Gene RIF (24)

AA Sequence

MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQMNYVSNVSKS      1 - 70
WLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSY     71 - 140
RQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDS    141 - 210
LQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFD    211 - 280
TSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDI    281 - 350
VLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSK    351 - 420
FESIRHSIAGIIRSPKSALGSSALSDMISISEKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPG    421 - 490
EYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITKKSGVVLLNPIPKDKKWILSH    491 - 560
EDVILGELLGKGNFGEVYKGTLKDKTSVAVKTCKEDLPQELKIKFLQEAKILKQYDHPNIVKLIGVCTQR    561 - 630
QPVYIIMELVSGGDFLTFLRRKKDELKLKQLVKFSLDAAAGMLYLESKNCIHRDLAARNCLVGENNVLKI    631 - 700
SDFGMSRQEDGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAR    701 - 770
EQVERGYRMSAPQHCPEDISKIMMKCWDYKPENRPKFSELQKELTIIKRKLT                      771 - 822
//

Text Mined References (77)

PMID Year Title