Property Summary

NCBI Gene PubMed Count 68
Grant Count 6
R01 Count 2
Funding $619,074.67
PubMed Score 53.14
PubTator Score 40.75

Knowledge Summary

Patent (46,693)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.535 0.001
diabetes mellitus -1.200 0.002
lung adenocarcinoma -1.400 0.000
invasive ductal carcinoma -1.400 0.001
ovarian cancer -2.300 0.000

Synonym

Accession P16591 B2RCR4 B4DSQ2 H2FLB8
Symbols TYK3
PPP1R74
p94-Fer

Gene

FER

PDB

2KK6  

  TechDev Info (1)

Gary Johnson 233 Kinome profile via MIB/MS Technology

 MGI Term (1)

Protein-protein Interaction (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (22)

PMID Text
25867068 Fer serves as a crucial mediator and amplifier of Src-induced tumor progression.
25533491 FER encodes a cytosolic non-receptor tyrosine kinase that influences neutrophil chemotaxis and endothelial permeability.
23931849 Detection of PJA2-FER fusion mRNA is correlated with poor postoperative survival periods in non-small cell lung cancer.
23906537 Fer contributes to aberrant androgen receptor signaling via pSTAT3 cross-talk during castrate-resistant prostate cancer progression.
23873028 FER kinase promotes breast cancer metastasis by regulating alpha6- and beta1-integrin-dependent cell adhesion and anoikis resistance.
23699534 data show that Fer kinase is elevated in non-small cell lung cancer tumors and is important for cellular invasion and metastasis
23445469 Fer expression correlates with renal cell carcinoma cell proliferation both in vitro and in vivo, and with tumor progression and survival
22238358 Fer, a non-receptor-type tyrosine kinase, plays a critical role in synthesis of the laminin-binding glycans on alpha-DG.
22223638 Transcription of the ferT gene in CC cells was found to be driven by an intronic promoter residing in intron 10 of the fer gene and to be regulated by the Brother of the Regulator of Imprinted Sites (BORIS) transcription factor.
21700879 The A allele of SNP rs10447248 in the FER locus was nominally associated with lower MMW (P = 0.016) but was not associated with LMW (P > 0.05) adiponectin levels
More...

AA Sequence

MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQMNYVSNVSKS      1 - 70
WLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSY     71 - 140
RQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDS    141 - 210
LQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFD    211 - 280
TSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDI    281 - 350
VLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSK    351 - 420
FESIRHSIAGIIRSPKSALGSSALSDMISISEKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPG    421 - 490
EYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITKKSGVVLLNPIPKDKKWILSH    491 - 560
EDVILGELLGKGNFGEVYKGTLKDKTSVAVKTCKEDLPQELKIKFLQEAKILKQYDHPNIVKLIGVCTQR    561 - 630
QPVYIIMELVSGGDFLTFLRRKKDELKLKQLVKFSLDAAAGMLYLESKNCIHRDLAARNCLVGENNVLKI    631 - 700
SDFGMSRQEDGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAR    701 - 770
EQVERGYRMSAPQHCPEDISKIMMKCWDYKPENRPKFSELQKELTIIKRKLT                      771 - 822
//

Publication (75)

PMID Year Title
25867068 2016 Fer tyrosine kinase oligomer mediates and amplifies Src-induced tumor progression.
25540073 2014 Integrative analysis of high-throughput RNAi screen data identifies the FER and CRKL tyrosine kinases as new regulators of the mitogenic ERK-dependent pathways in transformed cells.
25533491 2015 Genome-wide association study of survival from sepsis due to pneumonia: an observational cohort study.
25391905 2014 Tyrosine phosphorylation of LRP6 by Src and Fer inhibits Wnt/?-catenin signalling.
25381564 2014 Multiple tumor marker protein chip detection system in diagnosis of pancreatic cancer.
25347743 2015 Amplified Ras-MAPK signal states correlate with accelerated EGFR internalization, cytostasis and delayed HER2 tumor onset in Fer-deficient model systems.
25237066 2014 Oncogenic properties of a spermatogenic meiotic variant of fer kinase expressed in somatic cells.
25184253 2014 Phosphoproteomics-mediated identification of Fer kinase as a target of mutant Shp2 in Noonan and LEOPARD syndrome.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
More...